TkA05G139050 | RubberDandelionOmics

Gene overview

TkA05G139050

Reference: TK1151 Chr: Chr05 Coordinates: 36187981-36188445 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA05G139050|TK1151|cDNA

ATGGTCCTCGATGCACTGATTAAGATCAAAAACGAAATCGACCCTACGTTGTCGTTCCTTCACTCGTGCCGTGAAGGAATCTGCGGTTCTTGTGCTATGAGCATCGACGGATGTAACGACCTTGCTTGTCTGACGAAGATTACGTCGGGAGACGCCGCGATGATTACGCTTTTGCCGCATCTGTTTGTGATGAAGGATCTGGTGGTGGATATGATGATGATTACGCTTTATAAGGGATTTAGGATTCTCTTTAACCCCGA...

CDS

Download CDS FASTA

366 bp · TkA05G139050|TK1151|CDS

ATGGTCCTCGATGCACTGATTAAGATCAAAAACGAAATCGACCCTACGTTGTCGTTCCTTCACTCGTGCCGTGAAGGAATCTGCGGTTCTTGTGCTATGAGCATCGACGGATGTAACGACCTTGCTTGTCTGACGAAGATTACGTCGGGAGACGCCGCGATGATTACGCTTTTGCCGCATCTGTTTGTGATGAAGGATCTGGTGGTGGATATGATGATGATTACGCTTTATAAGGGATTTAGGATTCTCTTTAACCCCGA...

Protein

Download Protein FASTA

121 aa · TkA05G139050|TK1151|PROTEIN

MVLDALIKIKNEIDPTLSFLHSCREGICGSCAMSIDGCNDLACLTKITSGDAAMITLLPHLFVMKDLVVDMMMITLYKGFRILFNPDFYFSYDLISFTAATFTQVYVFVDDVVAQITDIHG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G139050`
TK1151 ID	TkA05G139050
OH-1004 ID	LXL04_006079
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.900
Protein coverage (%)	TK1151 58.678 / OH-1004 25.632 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G139050

Location Chr05:36187981-36188445 (+)

Description Similar to SDH2-2: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40650`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release
`At3g27380`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0120000`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006079 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006121 mitochondrial electron transport, succinate to ubiquinone Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045273 respiratory chain complex II (succinate dehydrogenase) Cellular Component

GO:0000104 succinate dehydrogenase activity Molecular Function

KEGG gene cross-reference

ath:AT3G27380

ath:AT5G40650

dme:Dmel_CG3283

dosa:Os08g0120000

spo:2542842

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.530

Rank 1 · TkA05G139050 · TK1151

Extracellular0.133

Rank 2 · TkA05G139050 · TK1151

Mitochondrion0.089

Rank 3 · TkA05G139050 · TK1151

Cytoplasm0.072

Rank 4 · TkA05G139050 · TK1151

Lysosome / Vacuole0.055

Rank 5 · TkA05G139050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13085Fer2_31-72 aa

PF00111Fer217-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G139050	`PF13085`	Fer2_3	1	72	5.2e-23	81.8
TkA05G139050	`PF00111`	Fer2	17	36	0.013	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB02`	Arabidopsis thaliana	sp\|Q8LB02\|SDHB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial	77.800%	Swiss-Prot	Medium
`Q8LBZ7`	Arabidopsis thaliana	sp\|Q8LBZ7\|SDHB1_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial	75.000%	Swiss-Prot	Medium
`Q9S827`	Oryza sativa subsp. japonica	sp\|Q9S827\|SDHB1_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial	72.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card