Gene Card
Gene overview
cDNA / CDS / Protein Sequences
868 bp · TkA05G115630|TK1151|cDNA
TTCTCCCACTCGCCAATTCCTTTTCATCTCCCCCATACAAACCACCTCTTCAGCTTCCGATCTCAATCACAAAACAATGGCCGCCGCGAGATTCATCAAGTGCGTCACCGTCGGCGACGGCGCCGTTGGAAAGACATGCATGCTCATCTCCTACACCAGCAATACATTCCCCACCGATTACGTGCCTACTGTGTTTGATAACTTCAGTGCTAATGTCGTGGTTGGTGAGAGCACTGTAAATCTCGGCCTTTGGGATACTG...
591 bp · TkA05G115630|TK1151|CDS
ATGGCCGCCGCGAGATTCATCAAGTGCGTCACCGTCGGCGACGGCGCCGTTGGAAAGACATGCATGCTCATCTCCTACACCAGCAATACATTCCCCACCGATTACGTGCCTACTGTGTTTGATAACTTCAGTGCTAATGTCGTGGTTGGTGAGAGCACTGTAAATCTCGGCCTTTGGGATACTGCAGGTCAGGAGGATTATAATAGACTGAGACCACTGAGTTACAGAGGAGCAGATGTCTTTCTATTGGCTTTTTCTCT...
Protein
Download Protein FASTA196 aa · TkA05G115630|TK1151|PROTEIN
MAAARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVGESTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSYENISKKWISELRHYAPTVPIVLVGTKLDLREDKQYLSDHPNATPITTSQGEELKKTIGAAVYIECSSKTQQNVKAVFDAAIRVVLQPPKLKKRRSKQRLCVYL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G115630 |
|---|---|
| TK1151 ID | TkA05G115630 |
| OH-1004 ID | LXL04_019999 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G115630 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:30856401-30858370 (-) | |||||||||
| Description | Similar to RAC2: Rac-like GTP-binding protein RAC2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007015 actin filament organization Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0007165 signal transduction Biological Process GO:0007264 small GTPase-mediated signal transduction Biological Process GO:0008360 regulation of cell shape Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009834 plant-type secondary cell wall biogenesis Biological Process GO:0009958 positive gravitropism Biological Process GO:0010928 regulation of auxin mediated signaling pathway Biological Process GO:0030865 cortical cytoskeleton organization Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0043622 cortical microtubule organization Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G35020 dosa:Os02g0312600 ghi:107924928 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00025Arf5-79 aaPF00009GTP_EFTU7-23 aaPF00071Ras8-178 aaPF08477Roc8-121 aaPF00009GTP_EFTU45-176 aaPF03481Sua5_C105-149 aaPF08477Roc145-162 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G115630 | PF00025 | Arf | 5 | 79 | 0.0018 | 18.5 |
| TkA05G115630 | PF00009 | GTP_EFTU | 7 | 23 | 0.0032 | 17.8 |
| TkA05G115630 | PF00071 | Ras | 8 | 178 | 4.6e-50 | 170.1 |
| TkA05G115630 | PF08477 | Roc | 8 | 121 | 5.3e-24 | 85.5 |
| TkA05G115630 | PF00009 | GTP_EFTU | 45 | 176 | 0.0032 | 17.8 |
| TkA05G115630 | PF03481 | Sua5_C | 105 | 149 | 0.11 | 13.9 |
| TkA05G115630 | PF08477 | Roc | 145 | 162 | 5.3e-24 | 85.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.