TkA05G113030 | RubberDandelionOmics

Gene overview

TkA05G113030

Reference: TK1151 Chr: Chr05 Coordinates: 30208914-30209875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

881 bp · TkA05G113030|TK1151|cDNA

GTAGCCACCAAAAAAGTAAAAGCCGACCCGCGAGCCGAGCCGCGGTACGCGGAGCGGATACCCTACGTGGTGGTCCACGGTGAGCCCGGTGCACGCCTCTCCGACATGGTGATCGACCCGTTGGATCTGTTAGCGGTCGATTCGCGTTTCCGACTAAACGACTTGTATTACATTAATAAACAAATAATCCCGGCGTTACAACGGGTGTTTGGGCTTGTGGGGGCGGACTTGAACCAATGGTTTTTGGACATGCCGAAAAT...

CDS

Download CDS FASTA

660 bp · TkA05G113030|TK1151|CDS

GTAGCCACCAAAAAAGTAAAAGCCGACCCGCGAGCCGAGCCGCGGTACGCGGAGCGGATACCCTACGTGGTGGTCCACGGTGAGCCCGGTGCACGCCTCTCCGACATGGTGATCGACCCGTTGGATCTGTTAGCGGTCGATTCGCGTTTCCGACTAAACGACTTGTATTACATTAATAAACAAATAATCCCGGCGTTACAACGGGTGTTTGGGCTTGTGGGGGCGGACTTGAACCAATGGTTTTTGGACATGCCGAAAAT...

Protein

Download Protein FASTA

219 aa · TkA05G113030|TK1151|PROTEIN

VATKKVKADPRAEPRYAERIPYVVVHGEPGARLSDMVIDPLDLLAVDSRFRLNDLYYINKQIIPALQRVFGLVGADLNQWFLDMPKMVRESAGKNMGYGPNNSHRTRIDYYYLSKHCIMCGELVQASVSPLCGECARNEAAVVVAVTGRTCKMEKEMQHLAAICRECGGGDWAIESGVKCTSLACSVFYERRKLQKELRSLSGVATQSGFYPKCVAEWF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G113030`
TK1151 ID	TkA05G113030
OH-1004 ID	LXL04_038958
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 12.587 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G113030

Location Chr05:30208914-30209875 (-)

Description Similar to REV3: DNA polymerase zeta catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67500`	Catalytic subunit of the error prone DNA polymerase zeta.	Disruption of the AtREV3 gene causes hypersensitivity to ultraviolet B light and gamma-rays in Arabidopsis: implication of the presence of a translesion synthesis mechanism in plants.2003 · DOI: 10.1105/tpc.012369 Roles of Arabidopsis AtREV1 and AtREV7 in translesion synthesis.2005 · DOI: 10.1104/pp.105.060236 RAD5a and REV3 function in two alternative pathways of DNA-damage tolerance in Arabidopsis.2011 · DOI: 10.1016/j.dnarep.2011.04.009

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009411 response to UV Biological Process

GO:0010224 response to UV-B Biological Process

GO:0019985 translesion synthesis Biological Process

GO:0042276 error-prone translesion synthesis Biological Process

GO:0071494 cellular response to UV-C Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G67500

hsa:5980

mmu:19714

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.488

Rank 1 · TkA05G113030 · TK1151

Cytoplasm0.453

Rank 2 · TkA05G113030 · TK1151

Mitochondrion0.067

Rank 3 · TkA05G113030 · TK1151

Cell membrane0.055

Rank 4 · TkA05G113030 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA05G113030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00136DNA_pol_B4-70 aa

PF01155HypA110-142 aa

PF07191Zn_ribbon_6113-137 aa

PF18912DZR_2115-167 aa

PF22908PHD_NSD115-134 aa

PF14260zf-C4pol117-191 aa

PF01155HypA147-179 aa

PF07191Zn_ribbon_6149-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G113030	`PF00136`	DNA_pol_B	4	70	2.5e-05	24.0
TkA05G113030	`PF01155`	HypA	110	142	1.5	9.6
TkA05G113030	`PF07191`	Zn_ribbon_6	113	137	7.4	7.4
TkA05G113030	`PF18912`	DZR_2	115	167	1.4	9.5
TkA05G113030	`PF22908`	PHD_NSD	115	134	8.5	7.5
TkA05G113030	`PF14260`	zf-C4pol	117	191	3.1e-14	53.7
TkA05G113030	`PF01155`	HypA	147	179	1.5	9.6
TkA05G113030	`PF07191`	Zn_ribbon_6	149	168	7.4	7.4
TkA05G113030	`PF18912`	DZR_2	159	169	1.4	9.5
TkA05G113030	`PF22908`	PHD_NSD	159	192	8.5	7.5
TkA05G113030	`PF22908`	PHD_NSD	210	218	8.5	7.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q766Z3`	Arabidopsis thaliana	sp\|Q766Z3\|REV3_ARATH DNA polymerase zeta catalytic subunit	70.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card