Gene Card
Gene overview
cDNA / CDS / Protein Sequences
555 bp · TkA05G111580|TK1151|cDNA
ATGCTCTCTCAGTCCGATTCTCTTGCACGCCTTCTCTCCCAAGCGGCCGCCATCGTACAGACACCATACCTTCCCTCTCCATCAATCCATACCTCTATCTTCATAGGGAGTACGTTAATTTCCAAATTGGAAGGGGCTTTCGGTGCCACCACCACCGCACCAAGAATAATTACTGTCGAAGCTGTCTCGGTTCAAGATTTTCTTCCCGAATTTGTTGAATTGGAATTGCAAACAACAGAATCCATGAACTTCCTAATGAC...
555 bp · TkA05G111580|TK1151|CDS
ATGCTCTCTCAGTCCGATTCTCTTGCACGCCTTCTCTCCCAAGCGGCCGCCATCGTACAGACACCATACCTTCCCTCTCCATCAATCCATACCTCTATCTTCATAGGGAGTACGTTAATTTCCAAATTGGAAGGGGCTTTCGGTGCCACCACCACCGCACCAAGAATAATTACTGTCGAAGCTGTCTCGGTTCAAGATTTTCTTCCCGAATTTGTTGAATTGGAATTGCAAACAACAGAATCCATGAACTTCCTAATGAC...
Protein
Download Protein FASTA184 aa · TkA05G111580|TK1151|PROTEIN
MLSQSDSLARLLSQAAAIVQTPYLPSPSIHTSIFIGSTLISKLEGAFGATTTAPRIITVEAVSVQDFLPEFVELELQTTESMNFLMTMINIRDPCYTAFHDEEWGVPVHDDKKLFELLSLSTNLAELTWPTILQKRHLFRYTWKKVTKGTVVFDLKSSTSNPSTDPDIRSCNNIGDKNQLNGCF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G111580 |
|---|---|
| TK1151 ID | TkA05G111580 |
| OH-1004 ID | LXL04_020640 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 62.700 |
| Protein coverage (%) | TK1151 72.826 / OH-1004 81.283Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G111580 |
|---|---|
| Location | Chr05:29909680-29911400 (-) |
| Description | Similar to tag: DNA-3-methyladenine glycosylase 1 (Escherichia coli (strain K12) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006284 base-excision repair Biological Process GO:0006307 DNA alkylation repair Biological Process GO:0005829 cytosol Cellular Component GO:0003921 GMP synthase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008725 DNA-3-methyladenine glycosylase activity Molecular Function GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | ecj:JW3518 eco:b3549 ecoc:C3026_19240 hhe:HH_1444 hin:HI_0654 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03352Adenine_glyco92-146 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G111580 | PF03352 | Adenine_glyco | 92 | 146 | 2.4e-18 | 67.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.