TkA05G110260 | RubberDandelionOmics

Gene overview

TkA05G110260

Reference: TK1151 Chr: Chr05 Coordinates: 29554114-29555716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1139 bp · TkA05G110260|TK1151|cDNA

ATCTCATAAAAAAGTTACGGATGCTAATGAGTAAAATATATAAAAGCTGAATATTATTTTAAACGATTTATGCCGAAATACACATGGTACAAGTTGAAAGAAAAAATAAATAGAAATATAGTCTCCCTTATCTGTAGCCATAATACATGCCAGCCTAACACCACTTCACAGTTCACATATTCCTCTTGTTGAGTTTCTATCATAAAAGCCAACCCATTCCAACTCATTCTTACTTACCCCCACCCCCATATATCTTCCTC...

CDS

Download CDS FASTA

741 bp · TkA05G110260|TK1151|CDS

ATGGCTGCCACTCTCATTCTTTTGTCGCTTACCCACCTCCTGTTCCTCCTCCCGTCAACTCTTTCCCAAACACCGTCTGCCCCTGCTCCAGGCCCCGCCGGACCCATCAACATCACCGCAATCCTCGTCCAAGGCGGCCAATACACCGCCTTCCTCCGCCTCCTCAACCAAACCCAGGTCCTCACCCAACTCCCTAACCAGCTCAACAACTCCAACCAGGGCATGACCCTTCTCGCACCCACCGATAACGCCTTCCAGAA...

Protein

Download Protein FASTA

246 aa · TkA05G110260|TK1151|PROTEIN

MAATLILLSLTHLLFLLPSTLSQTPSAPAPGPAGPINITAILVQGGQYTAFLRLLNQTQVLTQLPNQLNNSNQGMTLLAPTDNAFQNLPSGTLNGLTDDKKVKLVLYHVLPKYYSLEDLVSVSNPVPTQAGGSKGSLGLNFSGRANSNQVNVSSGVVDTQITNALRQQFPFAVYSVDKVLLPSEFSEAPAPESGPSSSPPVGKKPAAKGPSAPADGDASSPSNNGGGRRMEVGLVGGVVLFCMAFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G110260`
TK1151 ID	TkA05G110260
OH-1004 ID	LXL04_019984
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G110260

Location Chr05:29554114-29555716 (-)

Description Similar to FLA6: Fasciclin-like arabinogalactan protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03870`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At5g44130`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g20520`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At5g03170`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At5g60490`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019984 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009612 response to mechanical stimulus Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:1901348 positive regulation of secondary cell wall biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009531 secondary cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G03870

ath:AT2G20520

ath:AT5G03170

ath:AT5G44130

ath:AT5G60490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.583

Rank 1 · TkA05G110260 · TK1151

Extracellular0.204

Rank 2 · TkA05G110260 · TK1151

Endoplasmic reticulum0.127

Rank 3 · TkA05G110260 · TK1151

Cytoplasm0.095

Rank 4 · TkA05G110260 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA05G110260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469Fasciclin47-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G110260	`PF02469`	Fasciclin	47	182	8.4e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWA8`	Arabidopsis thaliana	sp\|Q9ZWA8\|FLA9_ARATH Fasciclin-like arabinogalactan protein 9	52.500%	Swiss-Prot	High
`Q9FFH6`	Arabidopsis thaliana	sp\|Q9FFH6\|FLA13_ARATH Fasciclin-like arabinogalactan protein 13	57.200%	Swiss-Prot	High
`Q9SIL7`	Arabidopsis thaliana	sp\|Q9SIL7\|FLA6_ARATH Fasciclin-like arabinogalactan protein 6	50.600%	Swiss-Prot	High
`Q8LEJ6`	Arabidopsis thaliana	sp\|Q8LEJ6\|FLA11_ARATH Fasciclin-like arabinogalactan protein 11	50.900%	Swiss-Prot	Medium
`Q8LEE9`	Arabidopsis thaliana	sp\|Q8LEE9\|FLA12_ARATH Fasciclin-like arabinogalactan protein 12	46.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card