TkA05G107130 | RubberDandelionOmics

Gene overview

TkA05G107130

Reference: TK1151 Chr: Chr05 Coordinates: 28690230-28691397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA05G107130|TK1151|cDNA

ATGTTGGTCAGTTACGGGTCAATGGTGGTCTATCGAAGACGATGCAGCTTGATTTCGTTAGTCCTGGCTATGGGATACCTCATTGGATGCAATGTATACTACATGAGTGGGGACGCATGGAAGGAAGGAGGTATTGATGCCACTGGAGCTCTTATGGTGATAACATTAAAAGTGATTTCATGTGCTGTAAATTACAACGACGGATTGTTAAAAGAACCATTTTTAGCGACGGATTTGCGACGGCTAAATCTGTTCCAACA...

CDS

Download CDS FASTA

312 bp · TkA05G107130|TK1151|CDS

ATGTTGGTCAGTTACGGGTCAATGGTGGTCTATCGAAGACGATGCAGCTTGATTTCGTTAGTCCTGGCTATGGGATACCTCATTGGATGCAATGTATACTACATGAGTGGGGACGCATGGAAGGAAGGAGGTATTGATGCCACTGGAGCTCTTATGGTGATAACATTAAAAGTGATTTCATGTGCTGTAAATTACAACGACGGATTGTTAAAAGAACCATTTTTAGCGACGGATTTGCGACGGCTAAATCTGTTCCAACA...

Protein

Download Protein FASTA

103 aa · TkA05G107130|TK1151|PROTEIN

MLVSYGSMVVYRRRCSLISLVLAMGYLIGCNVYYMSGDAWKEGGIDATGALMVITLKVISCAVNYNDGLLKEPFLATDLRRLNLFQQFGKCHRQSVGNDVVGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G107130`
TK1151 ID	TkA05G107130
OH-1004 ID	LXL04_005873
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.000
Protein coverage (%)	TK1151 88.350 / OH-1004 20.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G107130

Location Chr05:28690230-28691397 (+)

Description Similar to LPCAT1: Lysophospholipid acyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12640`	Lysophospholipid acyltransferase with broad specificity.	A family of eukaryotic lysophospholipid acyltransferases with broad specificity.2008 · DOI: 10.1016/j.febslet.2007.12.020 Acyl editing and headgroup exchange are the major mechanisms that direct polyunsaturated fatty acid flux into triacylglycerols.2012 · DOI: 10.1104/pp.112.204438 Metabolic interactions between the Lands cycle and the Kennedy pathway of glycerolipid synthesis in Arabidopsis developing seeds.2012 · DOI: 10.1105/tpc.112.104604 Plant acyl-CoA:lysophosphatidylcholine acyltransferases (LPCATs) have different specificities in their forward and reverse reactions.2013 · DOI: 10.1074/jbc.m113.521815 Metabolically Distinct Pools of Phosphatidylcholine Are Involved in Trafficking of Fatty Acids out of and into the Chloroplast for Membrane Production.2019 · DOI: 10.1105/tpc.19.00121
`At1g63050`	Lysophospholipid acyltransferase with broad specificity.	A family of eukaryotic lysophospholipid acyltransferases with broad specificity.2008 · DOI: 10.1016/j.febslet.2007.12.020 Acyl editing and headgroup exchange are the major mechanisms that direct polyunsaturated fatty acid flux into triacylglycerols.2012 · DOI: 10.1104/pp.112.204438 Metabolic interactions between the Lands cycle and the Kennedy pathway of glycerolipid synthesis in Arabidopsis developing seeds.2012 · DOI: 10.1105/tpc.112.104604 Plant acyl-CoA:lysophosphatidylcholine acyltransferases (LPCATs) have different specificities in their forward and reverse reactions.2013 · DOI: 10.1074/jbc.m113.521815 Metabolically Distinct Pools of Phosphatidylcholine Are Involved in Trafficking of Fatty Acids out of and into the Chloroplast for Membrane Production.2019 · DOI: 10.1105/tpc.19.00121

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005873 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006641 triglyceride metabolic process Biological Process

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0030258 lipid modification Biological Process

GO:0036150 phosphatidylserine acyl-chain remodeling Biological Process

GO:0036151 phosphatidylcholine acyl-chain remodeling Biological Process

GO:0036152 phosphatidylethanolamine acyl-chain remodeling Biological Process

GO:0045017 glycerolipid biosynthetic process Biological Process

GO:0046474 glycerophospholipid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G12640

ath:AT1G63050

gga:421925

mmu:67216

spo:2539940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.346

Rank 1 · TkA05G107130 · TK1151

Cytoplasm0.148

Rank 2 · TkA05G107130 · TK1151

Plastid0.131

Rank 3 · TkA05G107130 · TK1151

Endoplasmic reticulum0.129

Rank 4 · TkA05G107130 · TK1151

Nucleus0.085

Rank 5 · TkA05G107130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03062MBOAT33-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G107130	`PF03062`	MBOAT	33	83	0.00072	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDU4`	Arabidopsis thaliana	sp\|F4IDU4\|MBOA1_ARATH Lysophospholipid acyltransferase 1	56.700%	Swiss-Prot	High
`Q9CAN8`	Arabidopsis thaliana	sp\|Q9CAN8\|MBOA2_ARATH Lysophospholipid acyltransferase 2	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card