TkA05G101950 | RubberDandelionOmics

Gene overview

TkA05G101950

Reference: TK1151 Chr: Chr05 Coordinates: 27373309-27374986 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA05G101950|TK1151|cDNA

ATGGCTAATAGCAGTTCGCAACAACCCGAATGGCTAATAGCAGTTCGCAACAATCAGGTTTCGCCTAACTCCTTCCTAGTAGCTGGACAAGAATCACAAAAAGAAGTCGATGAAAGGATGTATAATCTGAAAAAGGCACTCCCACAAGAAATTTCAGACGAGCAATCAGACACCGGCGCAGCCGACGGGAGCAAAAACCTAATTTTCGAGGCAATGGCCTTTGTGTATATTTCGGTACAGAATTCGGAGGAGGTACGAGT...

CDS

Download CDS FASTA

414 bp · TkA05G101950|TK1151|CDS

ATGGCTAATAGCAGTTCGCAACAACCCGAATGGCTAATAGCAGTTCGCAACAATCAGGTTTCGCCTAACTCCTTCCTAGTAGCTGGACAAGAATCACAAAAAGAAGTCGATGAAAGGATGTATAATCTGAAAAAGGCACTCCCACAAGAAATTTCAGACGAGCAATCAGACACCGGCGCAGCCGACGGGAGCAAAAACCTAATTTTCGAGGCAATGGCCTTTGTGTATATTTCGGTACAGAATTCGGAGGAGGTACGAGT...

Protein

Download Protein FASTA

137 aa · TkA05G101950|TK1151|PROTEIN

MANSSSQQPEWLIAVRNNQVSPNSFLVAGQESQKEVDERMYNLKKALPQEISDEQSDTGAADGSKNLIFEAMAFVYISVQNSEEVRVALDQLPRDATDILDILKAEQAPLDLWLIIAVYEKAVEFVGPGCGGNILHG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G101950`
TK1151 ID	TkA05G101950
OH-1004 ID	LXL04_019893
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 84.672 / OH-1004 7.069 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G101950

Location Chr05:27373309-27374986 (+)

Description Similar to At1g65750: Putative ribonuclease H protein At1g65750

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g06210`	Component of the PAF1 complex (PAF1C) which is involved in histone modifications such as methylation on histone H3 'Lys-4' (H3K4me3).	A mechanism related to the yeast transcriptional regulator Paf1c is required for expression of the Arabidopsis FLC/MAF MADS box gene family.2004 · DOI: 10.1105/tpc.104.026062 PAF1-complex-mediated histone methylation of FLOWERING LOCUS C chromatin is required for the vernalization-responsive, winter-annual habit in Arabidopsis.2004 · DOI: 10.1101/gad.1244504 Identification of the Arabidopsis REDUCED DORMANCY 2 gene uncovers a role for the polymerase associated factor 1 complex in seed dormancy.2011 · DOI: 10.1371/journal.pone.0022241

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019893 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0032197 retrotransposition Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0016593 Cdc73/Paf1 complex Cellular Component

GO:0000993 RNA polymerase II complex binding Molecular Function

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G06210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.504

Rank 1 · TkA05G101950 · TK1151

Cytoplasm0.434

Rank 2 · TkA05G101950 · TK1151

Mitochondrion0.088

Rank 3 · TkA05G101950 · TK1151

Cell membrane0.072

Rank 4 · TkA05G101950 · TK1151

Extracellular0.056

Rank 5 · TkA05G101950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X0I6`	Arabidopsis thaliana	sp\|B5X0I6\|VIP6_ARATH Protein CTR9 homolog	89.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card