TkA05G101660 | RubberDandelionOmics

Gene overview

TkA05G101660

Reference: TK1151 Chr: Chr05 Coordinates: 27307375-27310145 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1390 bp · TkA05G101660|TK1151|cDNA

ATGAAAAATTATATATCGATTCCTTACGGACTGAAATAGATATTAGCCAAAACTGTAGGTGTAAATGACAAACAATATGCTTGTTGGCTTTGGGAGAATCCATTCAAAAGGCCACCTCGGCAAAGAGTACCCATGTTTTCCGAGTCTCAGCTTCAATGGTCTACGCGTGTCTCGTCATCCACGATTTGAGTCAAATGCTTCGTCGGTGGCGGCTATATCTTCTCCTTTAAAACTCACTGTTTCAGACCTTTTGAATCATC...

CDS

Download CDS FASTA

1053 bp · TkA05G101660|TK1151|CDS

ATGGGGTTTTACAGGCAGAACATTCAAGACTTTAGCCTATATCGAGGAACTCTTGGAACTGCGTTTTTGCTACTGAAATCCTATCAAGTTACCAACAACAAAAACGATCTTGATCTCTCTTCCGAGATTATTAAATCTTGCGATTCTGCTTCTTCCAGTTCCAGATTTGTGACATTTCTATTCGGGCGTGCTGGTGTTTGTGCACTTGGTGCTGTTGTGGCAAACCACCAAGGAAATGAGCATATGGTTGACTACTATTT...

Protein

Download Protein FASTA

350 aa · TkA05G101660|TK1151|PROTEIN

MGFYRQNIQDFSLYRGTLGTAFLLLKSYQVTNNKNDLDLSSEIIKSCDSASSSSRFVTFLFGRAGVCALGAVVANHQGNEHMVDYYLTQFKEIKVSEDVPDEIIFGRAGYLSACLFINKNLGHETIPYTHTKVVIDKMIENGRKLGKKGKCPLMYEYKGERYWGVAHGVAGILNVLMHFELNQDVSVDVKESLKYMIKNRFLSGNYPKKEEDDVESDLLVYWCHGASGVALTLVKASEVFEDKEFLEAAIDASKVVWDRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G101660`
TK1151 ID	TkA05G101660
OH-1004 ID	LXL04_030995
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.500
Protein coverage (%)	TK1151 98.571 / OH-1004 84.314 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G101660

Location Chr05:27307375-27310145 (-)

Description Similar to GCR2: LanC-like protein GCR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20770`	May play a role in signaling.	The GCR2 gene family is not required for ABA control of seed germination and early seedling development in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0002982
`At1g52920`	May play a role in abscisic acid (ABA) signaling.	Genetic characterization reveals no role for the reported ABA receptor, GCR2, in ABA control of seed germination and early seedling development in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03291.x The GCR2 gene family is not required for ABA control of seed germination and early seedling development in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0002982
`At5g65280`	May play a role in signaling.	Genetic characterization reveals no role for the reported ABA receptor, GCR2, in ABA control of seed germination and early seedling development in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03291.x The GCR2 gene family is not required for ABA control of seed germination and early seedling development in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0002982

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030995 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010231 maintenance of seed dormancy Biological Process

GO:0031179 peptide modification Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G52920

ath:AT2G20770

ath:AT5G65280

hsa:55915

mmu:71835

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.663

Rank 1 · TkA05G101660 · TK1151

Nucleus0.258

Rank 2 · TkA05G101660 · TK1151

Mitochondrion0.103

Rank 3 · TkA05G101660 · TK1151

Peroxisome0.089

Rank 4 · TkA05G101660 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA05G101660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05147LANC_like8-349 aa

PF06662C5-epim_C22-50 aa

PF07944Beta-AFase-like_GH127_cat23-48 aa

PF06662C5-epim_C230-254 aa

PF07944Beta-AFase-like_GH127_cat233-297 aa

PF06662C5-epim_C276-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G101660	`PF05147`	LANC_like	8	349	9.6e-97	324.4
TkA05G101660	`PF06662`	C5-epim_C	22	50	0.03	14.5
TkA05G101660	`PF07944`	Beta-AFase-like_GH127_cat	23	48	0.21	11.2
TkA05G101660	`PF06662`	C5-epim_C	230	254	0.03	14.5
TkA05G101660	`PF07944`	Beta-AFase-like_GH127_cat	233	297	0.21	11.2
TkA05G101660	`PF06662`	C5-epim_C	276	298	0.03	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZQ6`	Arabidopsis thaliana	sp\|Q8VZQ6\|GCL2_ARATH LanC-like protein GCL2	61.900%	Swiss-Prot	High
`F4IEM5`	Arabidopsis thaliana	sp\|F4IEM5\|GCR2_ARATH LanC-like protein GCR2	59.700%	Swiss-Prot	High
`Q9FJN7`	Arabidopsis thaliana	sp\|Q9FJN7\|GCL1_ARATH LanC-like protein GCL1	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card