TkA05G101280 | RubberDandelionOmics

Gene overview

TkA05G101280

Reference: TK1151 Chr: Chr05 Coordinates: 27232699-27233176 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA05G101280|TK1151|cDNA

ATGAATCCGTTTCTGAACACGCCGTCTTTGTCTTTAATCTCTGGTACGGCTTCATACTCGCCGCTTTTTCTGGCGTCATTGTCTTCCGTGTTTCTAGATCCAATTGATTCTGATAATAACTATGCTCCGGTGAGTCTCACTACCACTACAATAGTGCAGTTACCACCACGTTCGGTGGCAGGAAATGCGTCGGAGTTCTGGGAGCAGCCGGATGGAGAAGGATACCGGCCCTGTTTGGATTTTAGTTTGAGTTATCGGAG...

CDS

Download CDS FASTA

408 bp · TkA05G101280|TK1151|CDS

ATGAATCCGTTTCTGAACACGCCGTCTTTGTCTTTAATCTCTGGTACGGCTTCATACTCGCCGCTTTTTCTGGCGTCATTGTCTTCCGTGTTTCTAGATCCAATTGATTCTGATAATAACTATGCTCCGGTGAGTCTCACTACCACTACAATAGTGCAGTTACCACCACGTTCGGTGGCAGGAAATGCGTCGGAGTTCTGGGAGCAGCCGGATGGAGAAGGATACCGGCCCTGTTTGGATTTTAGTTTGAGTTATCGGAG...

Protein

Download Protein FASTA

135 aa · TkA05G101280|TK1151|PROTEIN

MNPFLNTPSLSLISGTASYSPLFLASLSSVFLDPIDSDNNYAPVSLTTTTIVQLPPRSVAGNASEFWEQPDGEGYRPCLDFSLSYRRSEEFSEIFDVEYFRKTLKADIRVVSSLPTTHLVSWQSLENQNPHNVQH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G101280`
TK1151 ID	TkA05G101280
OH-1004 ID	LXL04_009415
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.600
Protein coverage (%)	TK1151 99.259 / OH-1004 38.703 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G101280

Location Chr05:27232699-27233176 (-)

Description Similar to OFUT37: O-fucosyltransferase 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63390`	O-fucosyltransferase 37.	No verified direct reference in this release
`At3g07900`	O-fucosyltransferase 24.	No verified direct reference in this release
`At2g44500`	May play a role in the biosynthesis of matrix polysaccharides and contribute to the biomechanics and development of the plant cell wall.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009415 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G76270

ath:AT2G44500

ath:AT3G07900

ath:AT5G63390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.464

Rank 1 · TkA05G101280 · TK1151

Cytoplasm0.395

Rank 2 · TkA05G101280 · TK1151

Cell membrane0.100

Rank 3 · TkA05G101280 · TK1151

Mitochondrion0.085

Rank 4 · TkA05G101280 · TK1151

Endoplasmic reticulum0.084

Rank 5 · TkA05G101280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22801KH_GLD-3_1st33-69 aa

PF10250O-FucT84-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G101280	`PF22801`	KH_GLD-3_1st	33	69	0.13	13.3
TkA05G101280	`PF10250`	O-FucT	84	120	0.00016	22.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMW3`	Arabidopsis thaliana	sp\|Q9FMW3\|OFT37_ARATH O-fucosyltransferase 37	35.200%	Swiss-Prot	Medium
`Q9SFC4`	Arabidopsis thaliana	sp\|Q9SFC4\|OFT24_ARATH O-fucosyltransferase 24	27.400%	Swiss-Prot	Low
`O64884`	Arabidopsis thaliana	sp\|O64884\|OFT20_ARATH O-fucosyltransferase 20	25.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card