TkA05G100830 | RubberDandelionOmics

Gene overview

TkA05G100830

Reference: TK1151 Chr: Chr05 Coordinates: 27126604-27126927 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA05G100830|TK1151|cDNA

TATACCAATCAAATTTCATTCAATCTCCAAATCCATCTATATATTCCAATCGATTCCACAATTTTTTTAAAACAATACATCGATCAAATAGAACCTTCAGGTGCCTATTTGTTCAACAATTTTTTCAATTTACTCAGCTCTGATTTAACTGAGCTCATCTTACTGGGCTCATCCTTCACGGCGGTGACAAAGTTGAAAACTAAACATGGCCTACGTCTGATCGTTGAAAACGAAGAGGAATGCTACAAAGCAATACATCT...

CDS

Download CDS FASTA

324 bp · TkA05G100830|TK1151|CDS

TATACCAATCAAATTTCATTCAATCTCCAAATCCATCTATATATTCCAATCGATTCCACAATTTTTTTAAAACAATACATCGATCAAATAGAACCTTCAGGTGCCTATTTGTTCAACAATTTTTTCAATTTACTCAGCTCTGATTTAACTGAGCTCATCTTACTGGGCTCATCCTTCACGGCGGTGACAAAGTTGAAAACTAAACATGGCCTACGTCTGATCGTTGAAAACGAAGAGGAATGCTACAAAGCAATACATCT...

Protein

Download Protein FASTA

107 aa · TkA05G100830|TK1151|PROTEIN

YTNQISFNLQIHLYIPIDSTIFLKQYIDQIEPSGAYLFNNFFNLLSSDLTELILLGSSFTAVTKLKTKHGLRLIVENEEECYKAIHLVHKLWSKVPGKFKDYIKTPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G100830`
TK1151 ID	TkA05G100830
OH-1004 ID	LXL04_032230
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 36.449 / OH-1004 5.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G100830

Location Chr05:27126604-27126927 (+)

Description Similar to RSH3: Probable GTP diphosphokinase RSH3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9M5P5`	Probable ppGpp (guanosine 3'-diphosphate 5'-diphosphate) synthetase that may be involved in a rapid plant ppGpp-mediated response to pathogens and other stresses.	No verified direct reference in this release
`At1g54130`	Possesses ppGpp (guanosine 3'-diphosphate 5'-diphosphate) synthetase activity in vitro and is able to functionally complement E.coli relA mutants.	Expression profiling of four RelA/SpoT-like proteins, homologues of bacterial stringent factors, in Arabidopsis thaliana.2008 · DOI: 10.1007/s00425-008-0758-5
`At3g14050`	Possesses ppGpp (guanosine 3'-diphosphate 5'-diphosphate) synthetase activity in vitro and is able to functionally complement E.coli relA mutants.	Expression profiling of four RelA/SpoT-like proteins, homologues of bacterial stringent factors, in Arabidopsis thaliana.2008 · DOI: 10.1007/s00425-008-0758-5
`UniProt: Q9M5P6`	Probable ppGpp (guanosine 3'-diphosphate 5'-diphosphate) synthetase that may be involved in a rapid plant ppGpp-mediated response to pathogens and other stresses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0442600`	Probable ppGpp (guanosine 3'-diphosphate 5'-diphosphate) synthetase that may be involved in a rapid plant ppGpp-mediated response to pathogens and other stresses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015969 guanosine tetraphosphate metabolic process Biological Process

GO:0015970 guanosine tetraphosphate biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008728 GTP diphosphokinase activity Molecular Function

GO:0016301 kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G54130

ath:AT3G14050

dosa:Os08g0457600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.354

Rank 1 · TkA05G100830 · TK1151

Cytoplasm0.208

Rank 2 · TkA05G100830 · TK1151

Plastid0.164

Rank 3 · TkA05G100830 · TK1151

Nucleus0.097

Rank 4 · TkA05G100830 · TK1151

Peroxisome0.084

Rank 5 · TkA05G100830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04607RelA_SpoT66-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G100830	`PF04607`	RelA_SpoT	66	107	3.7e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M5P5`	Arabidopsis thaliana	sp\|Q9M5P5\|RSH3L_ARATH Probable GTP diphosphokinase RSH3, chloroplastic	74.400%	Swiss-Prot	Low
`Q9SYH1`	Arabidopsis thaliana	sp\|Q9SYH1\|RSH3C_ARATH Probable GTP diphosphokinase RSH3, chloroplastic	74.400%	Swiss-Prot	Low
`Q9LVJ3`	Arabidopsis thaliana	sp\|Q9LVJ3\|RSH2C_ARATH Probable GTP diphosphokinase RSH2, chloroplastic	63.000%	Swiss-Prot	Low
`Q9M5P6`	Arabidopsis thaliana	sp\|Q9M5P6\|RSH2L_ARATH Probable GTP diphosphokinase RSH2, chloroplastic	63.000%	Swiss-Prot	Low
`Q67UU0`	Oryza sativa subsp. japonica	sp\|Q67UU0\|RSH3_ORYSJ Probable GTP diphosphokinase RSH3, chloroplastic	64.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card