TkA05G093900 | RubberDandelionOmics

Gene overview

TkA05G093900

Reference: TK1151 Chr: Chr05 Coordinates: 25348676-25349134 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · TkA05G093900|TK1151|cDNA

ATGGCTAATCGTGCGTACATTATTCATCGTTACCTTTATGCTACTTCCAACATCAATCTCCCGATTTTCTTTCAAAAATCGAAGTTATCGAGTGTTTGGAGCCAACACGTGAATTGGATGGGTTACGTCACGGTTGCGACAAATGAAGACGATATTCAAAGGCTAGGTCATCGAGATGTTGTGATCGCATCGCAAGGAACTGTAACTTACCTGGAATGGATACATGATCTGAAAGATATATTACATCCTGCTCATTTCAG...

CDS

Download CDS FASTA

459 bp · TkA05G093900|TK1151|CDS

ATGGCTAATCGTGCGTACATTATTCATCGTTACCTTTATGCTACTTCCAACATCAATCTCCCGATTTTCTTTCAAAAATCGAAGTTATCGAGTGTTTGGAGCCAACACGTGAATTGGATGGGTTACGTCACGGTTGCGACAAATGAAGACGATATTCAAAGGCTAGGTCATCGAGATGTTGTGATCGCATCGCAAGGAACTGTAACTTACCTGGAATGGATACATGATCTGAAAGATATATTACATCCTGCTCATTTCAG...

Protein

Download Protein FASTA

152 aa · TkA05G093900|TK1151|PROTEIN

MANRAYIIHRYLYATSNINLPIFFQKSKLSSVWSQHVNWMGYVTVATNEDDIQRLGHRDVVIASQGTVTYLEWIHDLKDILHPAHFSDDHSIKLESGLFDLYTSKENSCHTIARFQLANRFFLKLNELKRGMTVKNSVSRLQDIVSEPHLLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G093900`
TK1151 ID	TkA05G093900
OH-1004 ID	LXL04_019844
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 45.395 / OH-1004 46.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G093900

Location Chr05:25348676-25349134 (+)

Description Similar to At1g51440: Phospholipase A1-Igamma3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51440`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release
`At2g30550`	Acylhydrolase with broad specificity.	No verified direct reference in this release
`At1g06800`	Acylhydrolase with a broad specificity.	DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation.2010 · DOI: 10.1104/pp.110.155093

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010150 leaf senescence Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019433 triglyceride catabolic process Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G05800

ath:AT1G06800

ath:AT1G51440

ath:AT2G30550

ath:AT2G31690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.260

Rank 1 · TkA05G093900 · TK1151

Peroxisome0.190

Rank 2 · TkA05G093900 · TK1151

Mitochondrion0.148

Rank 3 · TkA05G093900 · TK1151

Plastid0.139

Rank 4 · TkA05G093900 · TK1151

Nucleus0.123

Rank 5 · TkA05G093900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13212DUF402027-146 aa

PF01764Lipase_361-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G093900	`PF13212`	DUF4020	27	146	0.051	14.0
TkA05G093900	`PF01764`	Lipase_3	61	116	0.0022	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8J6`	Arabidopsis thaliana	sp\|Q9C8J6\|PLA17_ARATH Phospholipase A1-Igamma3, chloroplastic	71.000%	Swiss-Prot	High
`Q3EBR6`	Arabidopsis thaliana	sp\|Q3EBR6\|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic	51.500%	Swiss-Prot	High
`Q941F1`	Arabidopsis thaliana	sp\|Q941F1\|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card