TkA05G090810 | RubberDandelionOmics

Gene overview

TkA05G090810

Reference: TK1151 Chr: Chr05 Coordinates: 24509422-24510645 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA05G090810|TK1151|cDNA

ATGGACATGGAACATGAGTTTCAAGCATTACGAGTTCAACTTGCTGAGAAGTCAAAGCGGTCAATTGAGCTTCAGAAAAAGGTAGTTATAATTCAGATGAATAACGGGGTAGATCATCCTTCAGAGTCTATTCATGTACTTCATGTAGGCAAAATGAGGATGAAACTTTGTAAAGGAAAAACAACTGTTGCTAAAGAATATTATTCGCCTTCAATGCACAAAAATATATTTAAAAGTACAGTTGTGTGGGGTCCCAGGTG...

CDS

Download CDS FASTA

366 bp · TkA05G090810|TK1151|CDS

ATGGACATGGAACATGAGTTTCAAGCATTACGAGTTCAACTTGCTGAGAAGTCAAAGCGGTCAATTGAGCTTCAGAAAAAGGTAGTTATAATTCAGATGAATAACGGGGTAGATCATCCTTCAGAGTCTATTCATGTACTTCATGTAGGCAAAATGAGGATGAAACTTTGTAAAGGAAAAACAACTGTTGCTAAAGAATATTATTCGCCTTCAATGCACAAAAATATATTTAAAAGTACAGTTGTGTGGGGTCCCAGGTG...

Protein

Download Protein FASTA

121 aa · TkA05G090810|TK1151|PROTEIN

MDMEHEFQALRVQLAEKSKRSIELQKKVVIIQMNNGVDHPSESIHVLHVGKMRMKLCKGKTTVAKEYYSPSMHKNIFKSTVVWGPRWWKCCISSTHSGSQRLDSNLLWDLNQKEKEMLLLC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G090810`
TK1151 ID	TkA05G090810
OH-1004 ID	LXL04_033946
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 60.331 / OH-1004 85.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G090810

Location Chr05:24509422-24510645 (-)

Description Similar to SCAB1: Stomatal closure-related actin-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26770`	Plant-specific actin binding protein that bundles and stabilizes microfilaments (MFs).	The plant-specific actin binding protein SCAB1 stabilizes actin filaments and regulates stomatal movement in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086546

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033946 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0003779 actin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26770

ath:AT2G40820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.517

Rank 1 · TkA05G090810 · TK1151

Cytoplasm0.364

Rank 2 · TkA05G090810 · TK1151

Cell membrane0.110

Rank 3 · TkA05G090810 · TK1151

Mitochondrion0.084

Rank 4 · TkA05G090810 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA05G090810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16712SCAB_CC1-27 aa

PF04201TPD522-55 aa

PF17684SCAB-PH27-73 aa

PF22936Pol_BBD41-77 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G090810	`PF16712`	SCAB_CC	1	27	0.00025	21.6
TkA05G090810	`PF04201`	TPD52	2	55	0.0021	19.0
TkA05G090810	`PF17684`	SCAB-PH	27	73	4.4e-17	63.0
TkA05G090810	`PF22936`	Pol_BBD	41	77	0.074	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48791`	Arabidopsis thaliana	sp\|O48791\|SCAB1_ARATH Stomatal closure-related actin-binding protein 1	71.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card