TkA05G087000 | RubberDandelionOmics

Gene overview

TkA05G087000

Reference: TK1151 Chr: Chr05 Coordinates: 23508609-23510357 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA05G087000|TK1151|cDNA

TGGAAGCAATATGGCAATCCAAAAACACATTAAAATTCTTGTGCAACTTGTGATAGTTGCTCTTGTTTTTGGCATTGCCAATGGCCATGGCATAAAAAAAGGGTTCTATCAAAAGACATGTCCGAGAGCTGAGGGCATTGTAAAGAGGACAACCACAAACCACATTTATCGAGCTCCTTCTCTTGCGGCTGCTTTGCTCCGAATGCACTTTCATGATTGTTTTGTTAGGGGATGAGATGGTTCTGTGCTATAAACTCTAC...

CDS

Download CDS FASTA

591 bp · TkA05G087000|TK1151|CDS

ATGCAATTCGATCAACAGATTAAGGGACCATATTGGCCAGTTCCATTAGGGAGAAGAGATGGAAGAGTATCCATAGCATCAGAGACTTTAACACAGTTACCTGCTCCTTTTGCAAACATTACTCAACTTAAAGCAAACTTTGCTTCAAAGGGCCTTAGCGTTAAAGACCTGGCAGTTCTTTCAGGAGGACATACTGTGGGGGTTTCTCACTGCTCTACAATCGCGACCCGATTATACAATTTTACTGGAAAAGGCGACAC...

Protein

Download Protein FASTA

196 aa · TkA05G087000|TK1151|PROTEIN

MQFDQQIKGPYWPVPLGRRDGRVSIASETLTQLPAPFANITQLKANFASKGLSVKDLAVLSGGHTVGVSHCSTIATRLYNFTGKGDTDPALDSKYVPKLKSICFPNDKTTLLSMDPGSTKSFDADYYSVVLKRRGLFQSDAELLNDKITSAYVKLQARSHGRTFYKDFQKSMVKMGKIGVLTGKAGEIRRHCAMVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G087000`
TK1151 ID	TkA05G087000
OH-1004 ID	LXL04_019782
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 97.449 / OH-1004 58.589 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G087000

Location Chr05:23508609-23510357 (+)

Description Similar to PER27: Peroxidase 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01190`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g15180`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05240`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05250`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05260`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019782 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009409 response to cold Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G05240

ath:AT1G05250

ath:AT1G05260

ath:AT3G01190

ath:AT5G15180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.628

Rank 1 · TkA05G087000 · TK1151

Lysosome / Vacuole0.130

Rank 2 · TkA05G087000 · TK1151

Cytoplasm0.093

Rank 3 · TkA05G087000 · TK1151

Cell membrane0.074

Rank 4 · TkA05G087000 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA05G087000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase7-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G087000	`PF00141`	peroxidase	7	158	5.7e-44	151.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43735`	Arabidopsis thaliana	sp\|Q43735\|PER27_ARATH Peroxidase 27	60.000%	Swiss-Prot	High
`Q9LXG3`	Arabidopsis thaliana	sp\|Q9LXG3\|PER56_ARATH Peroxidase 56	58.400%	Swiss-Prot	High
`P0DI10`	Arabidopsis thaliana	sp\|P0DI10\|PER1_ARATH Peroxidase 1	55.700%	Swiss-Prot	High
`Q67Z07`	Arabidopsis thaliana	sp\|Q67Z07\|PER2_ARATH Peroxidase 2	55.700%	Swiss-Prot	High
`O23044`	Arabidopsis thaliana	sp\|O23044\|PER3_ARATH Peroxidase 3	53.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card