TkA05G085920 | RubberDandelionOmics

Gene overview

TkA05G085920

Reference: TK1151 Chr: Chr05 Coordinates: 23216380-23219029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · TkA05G085920|TK1151|cDNA

ATGCATATCACCAACAGCGTGGGTTGCCCTTATCGTGCCCCATTGCTATCGGTCGATGAATATGATCATTGGAAACTTCGCATGGAACTTTTTTTAAAAGGAAAAGACAATGGAAAAGAAATTTGGAGATCGATAACTGAAGGCCCACATCTCCCTGCCAGGAGTGATACTGTTAACAACGTAGCAAGAACTCTAGGTGCTGAGGGGACTGTGGAACCTCAGTTAACGGCTCTGGATCTTGAGAAAATTGCAGCAGACAA...

CDS

Download CDS FASTA

1503 bp · TkA05G085920|TK1151|CDS

ATGCATATCACCAACAGCGTGGGTTGCCCTTATCGTGCCCCATTGCTATCGGTCGATGAATATGATCATTGGAAACTTCGCATGGAACTTTTTTTAAAAGGAAAAGACAATGGAAAAGAAATTTGGAGATCGATAACTGAAGGCCCACATCTCCCTGCCAGGAGTGATACTGTTAACAACGTAGCAAGAACTCTAGGTGCTGAGGGGACTGTGGAACCTCAGTTAACGGCTCTGGATCTTGAGAAAATTGCAGCAGACAA...

Protein

Download Protein FASTA

500 aa · TkA05G085920|TK1151|PROTEIN

MHITNSVGCPYRAPLLSVDEYDHWKLRMELFLKGKDNGKEIWRSITEGPHLPARSDTVNNVARTLGAEGTVEPQLTALDLEKIAADNSAISELVFGIPPSLFAHIKHCKSAKKIWDLLQDLLEGSDNVKEKRQSSVVNDYDTFTTAPGETVQSAANRFQICINNLSDHDVIRTPIEHNTKFINSLRKGWGNVKSCLISNGSLRKLTIYQLFDELRGHESYVNQTLREISGGPLALISNDSHDSSDASHMFSEIPPISDEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G085920`
TK1151 ID	TkA05G085920
OH-1004 ID	LXL04_025653
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	33.600
Protein coverage (%)	TK1151 89.600 / OH-1004 25.152 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G085920`
Location	Chr05:23216380-23219029 (+)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025653` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0032196 transposition Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA05G085920 · TK1151

Nucleus0.453

Rank 2 · TkA05G085920 · TK1151

Mitochondrion0.055

Rank 3 · TkA05G085920 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA05G085920 · TK1151

Cell membrane0.041

Rank 5 · TkA05G085920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13961DUF421920-36 aa

PF14223Retrotran_gag_281-212 aa

PF02932Neur_chan_memb291-407 aa

PF03966Trm112p366-378 aa

PF00098zf-CCHC372-386 aa

PF26445DUF8124405-441 aa

PF03966Trm112p491-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G085920	`PF13961`	DUF4219	20	36	0.0056	17.1
TkA05G085920	`PF14223`	Retrotran_gag_2	81	212	6.2e-12	46.3
TkA05G085920	`PF02932`	Neur_chan_memb	291	407	8.1	7.3
TkA05G085920	`PF03966`	Trm112p	366	378	0.5	11.0
TkA05G085920	`PF00098`	zf-CCHC	372	386	0.0056	17.4
TkA05G085920	`PF26445`	DUF8124	405	441	0.16	12.5
TkA05G085920	`PF03966`	Trm112p	491	499	0.5	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card