TkA05G081020 | RubberDandelionOmics

Gene overview

TkA05G081020

Reference: TK1151 Chr: Chr05 Coordinates: 21446043-21446863 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA05G081020|TK1151|cDNA

ATGGGTCCGAATAAAGCGTTTGTCGTACTTAAACAACCTCATGGTGGTTACGATAAAGTTGGTGCTACAGTTGTAGATTGGAAGAATTTTAAACTTGATTTAATTGCGTATGTTGGTGAGAATGATGCATACATGGTTGTCAACAAGATATTGAAGAAGCAACAATATTTGACATATTTTTCGTCCGAATATTCGGTTGGTAGTTATGGGACATTAACTGATGTATTTTGGACGGATGAAGAAGCCAAACGTAATTATCA...

CDS

Download CDS FASTA

432 bp · TkA05G081020|TK1151|CDS

ATGGGTCCGAATAAAGCGTTTGTCGTACTTAAACAACCTCATGGTGGTTACGATAAAGTTGGTGCTACAGTTGTAGATTGGAAGAATTTTAAACTTGATTTAATTGCGTATGTTGGTGAGAATGATGCATACATGGTTGTCAACAAGATATTGAAGAAGCAACAATATTTGACATATTTTTCGTCCGAATATTCGGTTGGTAGTTATGGGACATTAACTGATGTATTTTGGACGGATGAAGAAGCCAAACGTAATTATCA...

Protein

Download Protein FASTA

143 aa · TkA05G081020|TK1151|PROTEIN

MGPNKAFVVLKQPHGGYDKVGATVVDWKNFKLDLIAYVGENDAYMVVNKILKKQQYLTYFSSEYSVGSYGTLTDVFWTDEEAKRNYQAFGDVVAFDATFRTNKYVLYLNTFTGIDNYKRCVTFDARLLSCETIESYKWFLTKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G081020`
TK1151 ID	TkA05G081020
OH-1004 ID	LXL04_020758
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.800
Protein coverage (%)	TK1151 100.000 / OH-1004 26.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G081020`
Location	Chr05:21446043-21446863 (+)
Description	Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020758` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009639 response to red or far red light Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0010018 far-red light signaling pathway Biological Process GO:0010218 response to far red light Biological Process GO:0042753 positive regulation of circadian rhythm Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:1900056 negative regulation of leaf senescence Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G52520 ath:AT1G76320 ath:AT2G27110 ath:AT4G15090 ath:AT4G38180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.421

Rank 1 · TkA05G081020 · TK1151

Cytoplasm0.314

Rank 2 · TkA05G081020 · TK1151

Extracellular0.114

Rank 3 · TkA05G081020 · TK1151

Mitochondrion0.023

Rank 4 · TkA05G081020 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA05G081020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056ZSWIM1-3_RNaseH-like64-143 aa

PF10551MULE92-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G081020	`PF21056`	ZSWIM1-3_RNaseH-like	64	143	7.1e-06	26.7
TkA05G081020	`PF10551`	MULE	92	141	1.5e-09	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card