TkA05G076650 | RubberDandelionOmics

Gene overview

TkA05G076650

Reference: TK1151 Chr: Chr05 Coordinates: 20402390-20403792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA05G076650|TK1151|cDNA

ATGATCTTCAAATCCAAGATAAAATACGTAGCACTTGGAGGTCTGGTCTTATCTTTTCTATCACTGATTGTGCATATGTTTCTTGCAAATACGAGTGCAGAGCTAGTACAGTACCATGTGATGACAGGATTTATTGAAGATTTAAATATAAATGTCGTGGGAAAACAGGGTGGTGCATCCAGAAAGTTGTGGAAAAAGGTTAAGGCTTTAGAGGCTTTGCAGCCCTATGAAAAACCTATAAAGAAATATCCTGCTCTGGT...

CDS

Download CDS FASTA

453 bp · TkA05G076650|TK1151|CDS

ATGATCTTCAAATCCAAGATAAAATACGTAGCACTTGGAGGTCTGGTCTTATCTTTTCTATCACTGATTGTGCATATGTTTCTTGCAAATACGAGTGCAGAGCTAGTACAGTACCATGTGATGACAGGATTTATTGAAGATTTAAATATAAATGTCGTGGGAAAACAGGGTGGTGCATCCAGAAAGTTGTGGAAAAAGGTTAAGGCTTTAGAGGCTTTGCAGCCCTATGAAAAACCTATAAAGAAATATCCTGCTCTGGT...

Protein

Download Protein FASTA

150 aa · TkA05G076650|TK1151|PROTEIN

MIFKSKIKYVALGGLVLSFLSLIVHMFLANTSAELVQYHVMTGFIEDLNINVVGKQGGASRKLWKKVKALEALQPYEKPIKKYPALVHQNNGFIHAKIFGGFKKIRLSICDLVTISRLLNATLVIPELQESANSKGIGSEFKSFSYLYDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G076650`
TK1151 ID	TkA05G076650
OH-1004 ID	LXL04_025355
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 100.000 / OH-1004 23.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G076650

Location Chr05:20402390-20403792 (+)

Description Similar to EDA30: Protein EMBRYO SAC DEVELOPMENT ARREST 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03810`	Protein EMBRYO SAC DEVELOPMENT ARREST 30.	No verified direct reference in this release
`At3g30300`	O-fucosyltransferase 27.	No verified direct reference in this release
`At3g02250`	Glycosyltransferase involved in the formation of rhamnogalacturonan I (RG-I) oligosaccharides in the seed coat mucilage, which is a specialized cell wall with abundant RG-I (By similarity).	No verified direct reference in this release
`At5g15740`	Glycosyltransferase involved in the formation of rhamnogalacturonan I (RG-I) oligosaccharides in the seed coat mucilage, which is a specialized cell wall with abundant RG-I.	Pectin RG-I rhamnosyltransferases represent a novel plant-specific glycosyltransferase family.2018 · DOI: 10.1038/s41477-018-0217-7
`At2g03280`	Glycosyltransferase involved in the formation of rhamnogalacturonan I (RG-I) oligosaccharides in the seed coat mucilage, which is a specialized cell wall with abundant RG-I (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025355 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0048868 pollen tube development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G04910

ath:AT3G03810

ath:AT3G30300

ath:AT5G64600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.709

Rank 1 · TkA05G076650 · TK1151

Endoplasmic reticulum0.156

Rank 2 · TkA05G076650 · TK1151

Cytoplasm0.074

Rank 3 · TkA05G076650 · TK1151

Cell membrane0.050

Rank 4 · TkA05G076650 · TK1151

Extracellular0.043

Rank 5 · TkA05G076650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT97-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G076650	`PF10250`	O-FucT	97	149	1.3e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J2C8`	Arabidopsis thaliana	sp\|F4J2C8\|EDA30_ARATH Protein EMBRYO SAC DEVELOPMENT ARREST 30	58.000%	Swiss-Prot	High
`Q8GZ81`	Arabidopsis thaliana	sp\|Q8GZ81\|OFT27_ARATH O-fucosyltransferase 27	42.400%	Swiss-Prot	Medium
`Q93ZR8`	Arabidopsis thaliana	sp\|Q93ZR8\|RRT2_ARATH Rhamnogalacturonan I rhamnosyltransferase 1	42.900%	Swiss-Prot	Low
`Q4V398`	Arabidopsis thaliana	sp\|Q4V398\|RRT1_ARATH Rhamnogalacturonan I rhamnosyltransferase 1	40.800%	Swiss-Prot	Low
`Q6E279`	Arabidopsis thaliana	sp\|Q6E279\|RRT3_ARATH Rhamnogalacturonan I rhamnosyltransferase 4	36.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card