RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G076380
Reference: TK1151 Chr: Chr05 Coordinates: 20336800-20339889 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2347 bp · TkA05G076380|TK1151|cDNA

GTGTTGCTTGCAGGTGGAACGCCTTTAAGGGCACTGAAGTTGTTAGATAACGGAAATGCGATATTAATAGATGTTGTATCCAAAAGCATATTATGGCAGAGCTTTGAAACTCCAACAGATACTTTTCTTCCTGGCATGATGATGGGCGATAACTTGAAGTTGACATCATGGAAAAGTTTAGAAGACCCAGGAACTGGAAACTACGACTTTCAGATAGATCCTAATACAAAGCGTTACCTCATTTTGGACTCAAGCACATA...

CDS

Download CDS FASTA

2193 bp · TkA05G076380|TK1151|CDS

GTGTTGCTTGCAGGTGGAACGCCTTTAAGGGCACTGAAGTTGTTAGATAACGGAAATGCGATATTAATAGATGTTGTATCCAAAAGCATATTATGGCAGAGCTTTGAAACTCCAACAGATACTTTTCTTCCTGGCATGATGATGGGCGATAACTTGAAGTTGACATCATGGAAAAGTTTAGAAGACCCAGGAACTGGAAACTACGACTTTCAGATAGATCCTAATACAAAGCGTTACCTCATTTTGGACTCAAGCACATA...

Protein

Download Protein FASTA

730 aa · TkA05G076380|TK1151|PROTEIN

VLLAGGTPLRALKLLDNGNAILIDVVSKSILWQSFETPTDTFLPGMMMGDNLKLTSWKSLEDPGTGNYDFQIDPNTKRYLILDSSTYRWESAYMLKKSFDDNQIFSQAFFLLSNTTNQTRSFRSLNGIVYNQSYSVIDPYSRLVMSHTGHIQYFSFPSWKNLDWQEPKDNCSVFKVCGSFGICSVYKNSSSCSCLPGFEPVSPNDYSAGCTRTYDISCLPGTNDTFHTKYGISIDDPNILFQEAKNESTCMNKCLEKCQC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G076380
TK1151 IDTkA05G076380
OH-1004 IDLXL04_025435
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)47.000
Protein coverage (%)TK1151 94.247 / OH-1004 41.726
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G076380
LocationChr05:20336800-20339889 (-)
DescriptionSimilar to At4g03230: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g03230 G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230. No verified direct reference in this release
At4g27300 G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1. No verified direct reference in this release
At4g21390 G-type lectin S-receptor-like serine/threonine-protein kinase B120. No verified direct reference in this release
At4g21380 Involved in the regulation of cellular expansion and differentiation. No verified direct reference in this release
At1g65790 Involved in the regulation of cellular expansion and differentiation. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006955 immune response Biological Process
GO:0007165 signal transduction Biological Process
GO:0048544 recognition of pollen Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference
ath:AT4G03230
ath:AT4G21380
ath:AT4G27290
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.856
Rank 1 · TkA05G076380 · TK1151
Endoplasmic reticulum0.079
Rank 2 · TkA05G076380 · TK1151
Cytoplasm0.077
Rank 3 · TkA05G076380 · TK1151
Nucleus0.043
Rank 4 · TkA05G076380 · TK1151
Lysosome / Vacuole0.027
Rank 5 · TkA05G076380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin12-55 aa
PF00954S_locus_glycop131-201 aa
PF08276PAN_2190-194 aa
PF08276PAN_2222-285 aa
PF08695Coa1240-302 aa
PF00024PAN_1241-285 aa
PF00954S_locus_glycop247-261 aa
PF00069Pkinase411-679 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G076380PF01453B_lectin12551.2e-0939.3
TkA05G076380PF00954S_locus_glycop1312011.4e-1352.0
TkA05G076380PF08276PAN_21901948.7e-0832.9
TkA05G076380PF08276PAN_22222858.7e-0832.9
TkA05G076380PF08695Coa12403020.1412.7
TkA05G076380PF00024PAN_12412850.003318.0
TkA05G076380PF00954S_locus_glycop2472611.4e-1352.0
TkA05G076380PF00069Pkinase4116791.8e-42146.3
TkA05G076380PF07714PK_Tyr_Ser-Thr4146514.1e-46158.1
TkA05G076380PF03109ABC14144400.006316.4
TkA05G076380PF01636APH4514940.2711.7
TkA05G076380PF01636APH5275580.2711.7
TkA05G076380PF03109ABC15315720.006316.4
TkA05G076380PF11883DUF34036877300.000820.2
TkA05G076380PF01453B_lectin7047141.2e-0939.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZR08Arabidopsis thalianasp|Q9ZR08|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g0323049.200%Swiss-ProtMedium
O81833Arabidopsis thalianasp|O81833|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-142.400%Swiss-ProtMedium
O81906Arabidopsis thalianasp|O81906|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B12039.200%Swiss-ProtMedium
O81905Arabidopsis thalianasp|O81905|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-840.400%Swiss-ProtMedium
Q39086Arabidopsis thalianasp|Q39086|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-739.400%Swiss-ProtMedium

JBrowse

View in Genome Browser