TkA05G054100 | RubberDandelionOmics

Gene overview

TkA05G054100

Reference: TK1151 Chr: Chr05 Coordinates: 14436204-14439114 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · TkA05G054100|TK1151|cDNA

ATGGATGTCCACGGAAACGAAGATGATGACCTATACGATTTAGAATTTGAAGACAACTACCTTGGATACGTAAGTGACGAAGGGTCCACATTGTTTGTTGTTGACGAGGAACTAGAAGACAGTGATAAAGATGATTTTAATGGACATGAGGCTCGGGATGGGTGCTCTAAAGAATTTAATGAAGATGGAGTAGAAGATGAACTAGAGTATGGTACACATGACCCAAAGACATCATGGAGGCACATGAAACCACATATTGG...

CDS

Download CDS FASTA

1410 bp · TkA05G054100|TK1151|CDS

ATGGATGTCCACGGAAACGAAGATGATGACCTATACGATTTAGAATTTGAAGACAACTACCTTGGATACGTAAGTGACGAAGGGTCCACATTGTTTGTTGTTGACGAGGAACTAGAAGACAGTGATAAAGATGATTTTAATGGACATGAGGCTCGGGATGGGTGCTCTAAAGAATTTAATGAAGATGGAGTAGAAGATGAACTAGAGTATGGTACACATGACCCAAAGACATCATGGAGGCACATGAAACCACATATTGG...

Protein

Download Protein FASTA

469 aa · TkA05G054100|TK1151|PROTEIN

MDVHGNEDDDLYDLEFEDNYLGYVSDEGSTLFVVDEELEDSDKDDFNGHEARDGCSKEFNEDGVEDELEYGTHDPKTSWRHMKPHIGERHPNVEELRFCQCYRANKKDLEIINGKLIELYEHVWDYANYIFKIETQEVLQKMSTKHLNWDDVCPIILRMLIKWCVNMSKAHVLEVRLEFEAVHVDLEHGFCTCRLWEISGIPCVHACAAMNYTHQQPDTFIISNFSKAIFDQTYMGNIGPLNGSTMWGEPPYITPLPSIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G054100`
TK1151 ID	TkA05G054100
OH-1004 ID	LXL04_018434
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	32.900
Protein coverage (%)	TK1151 91.471 / OH-1004 60.863 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G054100`
Location	Chr05:14436204-14439114 (+)
Description	Similar to Polygalacturonase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018434` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0009830 cell wall modification involved in abscission Biological Process GO:0009835 fruit ripening Biological Process GO:0009901 anther dehiscence Biological Process GO:0010047 fruit dehiscence Biological Process GO:0010227 floral organ abscission Biological Process GO:0045490 pectin catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0048046 apoplast Cellular Component GO:0004650 polygalacturonase activity Molecular Function
KEGG gene cross-reference	ath:AT2G41850 ath:AT3G57510 sly:544051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · TkA05G054100 · TK1151

Cytoplasm0.202

Rank 2 · TkA05G054100 · TK1151

Cell membrane0.024

Rank 3 · TkA05G054100 · TK1151

Mitochondrion0.020

Rank 4 · TkA05G054100 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA05G054100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04434SWIM95-103 aa

PF14080DUF4261106-132 aa

PF04434SWIM183-212 aa

PF14080DUF4261436-464 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G054100	`PF04434`	SWIM	95	103	7.2e-09	35.7
TkA05G054100	`PF14080`	DUF4261	106	132	0.23	12.3
TkA05G054100	`PF04434`	SWIM	183	212	7.2e-09	35.7
TkA05G054100	`PF14080`	DUF4261	436	464	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card