TkA05G050440 | RubberDandelionOmics

Gene overview

TkA05G050440

Reference: TK1151 Chr: Chr05 Coordinates: 13435671-13444105 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2899 bp · TkA05G050440|TK1151|cDNA

ATATATTGTAAAAACCCCATAAGGCAAGAGGGGCACTATTATGTAAATTAGTAAGTGCGGTCTACTCGCCGCCTGTTATGCGCATGTTAACTGGTTAATTGCTATATAAGTTTTCGCGAGAATTCCGTTGCCCGCTTCCGACGCCGGTGTCTGTTCCTCCGCTTCGTGCGTTGGATTTTGCATTGACGTTACTGGACTTTGATGCCATTACCATTTCGTCTTTGAGGCCTACGTTTCCATGATGACAGATTTGGCGTGCA...

CDS

Download CDS FASTA

1446 bp · TkA05G050440|TK1151|CDS

ATGTTGGATATTTCTGTTGACATGATATACTCGCGCCTTGCTGGCAAAGAAATTCCCATGCTGGCAGTTGTGGATGATGGTCATGGAATGAGCCATGATGAGATTATGAAAATGGTGTCATTTGGTCGCGAGAAACGTGACACTGATGATCCAAATTATATCGGAAGATACGGTGTTGGCTTTAAGACTGGAACTATGAGACTTGGTAGGGATGCATTGGTTCTCACCCAAACTACAAATTCAAGATCAATTGCCTTTCT...

Protein

Download Protein FASTA

481 aa · TkA05G050440|TK1151|PROTEIN

MLDISVDMIYSRLAGKEIPMLAVVDDGHGMSHDEIMKMVSFGREKRDTDDPNYIGRYGVGFKTGTMRLGRDALVLTQTTNSRSIAFLSQSLNEGKDIIEIPIVTYSRKGQYMEFDTNIQTEALSKANLKAIMEFSPFNKYFIGEKAGLFQRKGTGTQIYVWNLDEWGSKYTLEWVNGMSGGSSFHQGDIFIRSRRARSRLGQMTREVPLDYSLRSYLEVIFLDPRMKINVQGSLVKSRPLARFLHKTSIESGCVSGKQVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G050440`
TK1151 ID	TkA05G050440
OH-1004 ID	LXL04_007221
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	26.500
Protein coverage (%)	TK1151 72.141 / OH-1004 56.098 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G050440`
Location	Chr05:13435671-13444105 (-)
Description	Similar to MORC1: Protein MICRORCHIDIA 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007221` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0031349 positive regulation of defense response Biological Process GO:0034052 positive regulation of plant-type hypersensitive response Biological Process GO:0051607 defense response to virus Biological Process GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process GO:0098542 defense response to other organism Biological Process
KEGG gene cross-reference	ath:AT1G19100 ath:AT4G24970 ath:AT4G36270 ath:AT4G36280 ath:AT4G36290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA05G050440 · TK1151

Cytoplasm0.084

Rank 2 · TkA05G050440 · TK1151

Cell membrane0.031

Rank 3 · TkA05G050440 · TK1151

Plastid0.018

Rank 4 · TkA05G050440 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA05G050440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13589HATPase_c_320-107 aa

PF13802Gal_mutarotas_2108-168 aa

PF17942Morc6_S5211-350 aa

PF07496zf-CW372-414 aa

PF07496zf-CW417-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G050440	`PF13589`	HATPase_c_3	20	107	2e-12	48.0
TkA05G050440	`PF13802`	Gal_mutarotas_2	108	168	0.016	16.2
TkA05G050440	`PF17942`	Morc6_S5	211	350	7.1e-12	46.3
TkA05G050440	`PF07496`	zf-CW	372	414	1.5e-12	48.0
TkA05G050440	`PF07496`	zf-CW	417	436	1.5e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card