TkA05G045120 | RubberDandelionOmics

Gene overview

TkA05G045120

Reference: TK1151 Chr: Chr05 Coordinates: 11927495-11931419 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3432 bp · TkA05G045120|TK1151|cDNA

ATGGTGAAGCCAATTATTGACGATTCATTAACGAATACAAAAGAAGGCGATGAAGAATCAGATAGGGATGAAACTATGAACCGATTGGGTTCGATACGATTAGGTGGGAAAATCGGAAAAGGGGGAAATTTAGATGGGGGCGTGATACCGGATCAAGCCATGATAGATGCGATTAGGGCAAAGAGGGAGAGACTGCGACAATCACGGGCCGCTGCCCCTGATTTCATAGCATTAGACGGAGGGAGTAATCATGGTGAAGC...

CDS

Download CDS FASTA

3432 bp · TkA05G045120|TK1151|CDS

ATGGTGAAGCCAATTATTGACGATTCATTAACGAATACAAAAGAAGGCGATGAAGAATCAGATAGGGATGAAACTATGAACCGATTGGGTTCGATACGATTAGGTGGGAAAATCGGAAAAGGGGGAAATTTAGATGGGGGCGTGATACCGGATCAAGCCATGATAGATGCGATTAGGGCAAAGAGGGAGAGACTGCGACAATCACGGGCCGCTGCCCCTGATTTCATAGCATTAGACGGAGGGAGTAATCATGGTGAAGC...

Protein

Download Protein FASTA

1143 aa · TkA05G045120|TK1151|PROTEIN

MVKPIIDDSLTNTKEGDEESDRDETMNRLGSIRLGGKIGKGGNLDGGVIPDQAMIDAIRAKRERLRQSRAAAPDFIALDGGSNHGEAEGLSDEEPEFQGRIALIGEKGDAKKGVFEDVVDVSNATFRKENVGNDSDDGVEDEEDEEDKMWEEEQFRKGLGKRIDEGVAVRGVSSSTIPTIVQNVQQKVAYPTVPVSSSLSSVYIVSRFLLPSSTATTATAAMSSSRIRNFRRRSEDDDNEDEDKEKTTTPAATTTISKKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G045120`
TK1151 ID	TkA05G045120
OH-1004 ID	LXL04_019348
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	68.900
Protein coverage (%)	TK1151 100.000 / OH-1004 53.591 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G045120

Location Chr05:11927495-11931419 (+)

Description Similar to ILP1: Transcriptional repressor ILP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08550`	Transcriptional repressor regulating endoreduplication through control of A-type cyclins expression.	Increased level of polyploidy1, a conserved repressor of CYCLINA2 transcription, controls endoreduplication in Arabidopsis.2006 · DOI: 10.1105/tpc.106.043869

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019348 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030371 translation repressor activity Molecular Function

KEGG gene cross-reference

ath:AT5G08550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.730

Rank 1 · TkA05G045120 · TK1151

Cytoplasm0.401

Rank 2 · TkA05G045120 · TK1151

Mitochondrion0.028

Rank 3 · TkA05G045120 · TK1151

Cell membrane0.023

Rank 4 · TkA05G045120 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA05G045120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15458NTR247-165 aa

PF08459UvrC_RNaseH_dom53-84 aa

PF13941MutL58-89 aa

PF07941K_channel_TID61-87 aa

PF19893DUF636661-92 aa

PF10509GalKase_gal_bdg99-113 aa

PF11067DUF2868137-176 aa

PF20439SpoIVA_C140-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G045120	`PF15458`	NTR2	47	165	3.8e-20	73.3
TkA05G045120	`PF08459`	UvrC_RNaseH_dom	53	84	0.00071	20.2
TkA05G045120	`PF13941`	MutL	58	89	0.003	17.1
TkA05G045120	`PF07941`	K_channel_TID	61	87	0.0044	18.2
TkA05G045120	`PF19893`	DUF6366	61	92	0.49	11.6
TkA05G045120	`PF10509`	GalKase_gal_bdg	99	113	0.11	12.8
TkA05G045120	`PF11067`	DUF2868	137	176	0.45	10.7
TkA05G045120	`PF20439`	SpoIVA_C	140	169	0.00014	22.7
TkA05G045120	`PF22251`	PFF1_TM	182	278	9.7	6.3
TkA05G045120	`PF15458`	NTR2	235	272	3.8e-20	73.3
TkA05G045120	`PF11067`	DUF2868	248	293	0.45	10.7
TkA05G045120	`PF30850`	DUF8750	281	306	1.3	9.8
TkA05G045120	`PF15458`	NTR2	361	476	3.8e-20	73.3
TkA05G045120	`PF08459`	UvrC_RNaseH_dom	385	419	0.00071	20.2
TkA05G045120	`PF13941`	MutL	390	421	0.003	17.1
TkA05G045120	`PF07941`	K_channel_TID	393	418	0.0044	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN3`	Arabidopsis thaliana	sp\|Q9FNN3\|ILP1_ARATH Transcriptional repressor ILP1	38.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card