TkA05G042080 | RubberDandelionOmics

Gene overview

TkA05G042080

Reference: TK1151 Chr: Chr05 Coordinates: 11205695-11206995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA05G042080|TK1151|cDNA

ATGCATCAACATCCTCCCCTCCGATCCTCTCTCCCCAGATTTCTCCAAGGAATCGTCGATTCAAAGTACTTCTGCGCCGCCGCAAGAAAACGCGGGTACGTTCACAACCTTCCGATTAAAAACCGTTTCCCGCTTCTCCCCCTTCCTCCTCGCACTGTCAACGACGCCCTACCCTTGACGAAACGGTGGTGGCCGGAATGGGACAAGCGAACTAAGCTTAACTGTTTACAAACGGTTATCGGAAGTGCTCGGTTGACTGA...

CDS

Download CDS FASTA

759 bp · TkA05G042080|TK1151|CDS

ATGCATCAACATCCTCCCCTCCGATCCTCTCTCCCCAGATTTCTCCAAGGAATCGTCGATTCAAAGTACTTCTGCGCCGCCGCAAGAAAACGCGGGTACGTTCACAACCTTCCGATTAAAAACCGTTTCCCGCTTCTCCCCCTTCCTCCTCGCACTGTCAACGACGCCCTACCCTTGACGAAACGGTGGTGGCCGGAATGGGACAAGCGAACTAAGCTTAACTGTTTACAAACGGTTATCGGAAGTGCTCGGTTGACTGA...

Protein

Download Protein FASTA

252 aa · TkA05G042080|TK1151|PROTEIN

MHQHPPLRSSLPRFLQGIVDSKYFCAAARKRGYVHNLPIKNRFPLLPLPPRTVNDALPLTKRWWPEWDKRTKLNCLQTVIGSARLTDRIRKELERCSDTDNPPPHVQNSRSWILKWNDRKSRGKSPMVDWFLVSPHLHRRLNFQMHQHPPLRSSLPRFLQGIVDSKYFCAAARKRGYVHNLPIKNRFPLLPLPPRTVNDALPLTKRWWPEWDKRTKLNCLQTVIGSARLTDRIRKELERCGDTDNPPPHVQK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G042080`
TK1151 ID	TkA05G042080
OH-1004 ID	LXL04_023963
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.900
Protein coverage (%)	TK1151 42.460 / OH-1004 19.110 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G042080

Location Chr05:11205695-11206995 (-)

Description Similar to DRM2: DNA (cytosine-5)-methyltransferase DRM2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9M548`	Involved in de novo DNA methylation.	No verified direct reference in this release
`UniProt: Q9LXE5`	Involved in de novo DNA methylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0110800`	Involved in de novo DNA methylation.	No verified direct reference in this release
`Os12g0108900`	Involved in de novo DNA methylation.	No verified direct reference in this release
`Os11g0109200`	Involved in de novo DNA methylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023963 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0032259 methylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003886 DNA (cytosine-5-)-methyltransferase activity Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0009008 DNA-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G14620

ath:AT5G15380

dosa:Os03g0110800

dosa:Os05g0133900

dosa:Os12g0108900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA05G042080 · TK1151

Nucleus0.261

Rank 2 · TkA05G042080 · TK1151

Mitochondrion0.106

Rank 3 · TkA05G042080 · TK1151

Extracellular0.081

Rank 4 · TkA05G042080 · TK1151

Lysosome / Vacuole0.063

Rank 5 · TkA05G042080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15524Ntox1727-72 aa

PF21191CvfB_1st54-70 aa

PF07683CobW_C59-96 aa

PF14893PNMA_C76-106 aa

PF15524Ntox17171-216 aa

PF21191CvfB_1st198-214 aa

PF07683CobW_C203-240 aa

PF14893PNMA_C220-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G042080	`PF15524`	Ntox17	27	72	0.16	12.8
TkA05G042080	`PF21191`	CvfB_1st	54	70	1.5	9.4
TkA05G042080	`PF07683`	CobW_C	59	96	0.21	12.2
TkA05G042080	`PF14893`	PNMA_C	76	106	0.072	13.3
TkA05G042080	`PF15524`	Ntox17	171	216	0.16	12.8
TkA05G042080	`PF21191`	CvfB_1st	198	214	1.5	9.4
TkA05G042080	`PF07683`	CobW_C	203	240	0.21	12.2
TkA05G042080	`PF14893`	PNMA_C	220	250	0.072	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M548`	Arabidopsis thaliana	sp\|Q9M548\|DRM2_ARATH DNA (cytosine-5)-methyltransferase DRM2	60.600%	Swiss-Prot	Low
`Q9LXE5`	Arabidopsis thaliana	sp\|Q9LXE5\|DRM1L_ARATH DNA (cytosine-5)-methyltransferase DRM1	53.900%	Swiss-Prot	Low
`Q10SU5`	Oryza sativa subsp. japonica	sp\|Q10SU5\|DRM2_ORYSJ DNA (cytosine-5)-methyltransferase DRM2	57.300%	Swiss-Prot	Low
`Q2QYR5`	Oryza sativa subsp. japonica	sp\|Q2QYR5\|DRM1B_ORYSJ Probable inactive DNA (cytosine-5)-methyltransferase DRM1B	55.600%	Swiss-Prot	Low
`Q2RBJ4`	Oryza sativa subsp. japonica	sp\|Q2RBJ4\|DRM1A_ORYSJ DNA (cytosine-5)-methyltransferase DRM1A	68.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card