RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G035080
Reference: TK1151 Chr: Chr05 Coordinates: 9486792-9491757 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3191 bp · TkA05G035080|TK1151|cDNA

CCTGGATTCCTTTTTCTACGTGGCCTTCTCTCCATTATAGATGGCGTACGTGTTGCCTCAGTTGGGAGAACACGACTTCGCCTTCCACCGCCTTCATCGCCACCTTCTTTTATTCAATGAAATCCTCTCCTTCGCCTTTTTTTATCTAATAAAATCAGCGTCTTGCACCTCCTTCAATCGACAAAGTTAAACCTTTCCCTCCACTCCGATCGACCGCTTCATCCACCATCGGGTTTGTCTCTTCAATTGTTGGGCGAGTC...

CDS

Download CDS FASTA

1539 bp · TkA05G035080|TK1151|CDS

ATGTCTCACAAATCTAAAGGAGCAGCCATCGGCATTGATCTTGGAACCACTTATTCATGTGCCGGTGTTTGGTTTCACCAAAAAAATCGGGTCGAAATTATACCTAATGAACAAGGAAACAAAGTAACTCCATCGTTCATATCGTTCAGTGACGAAGAGGTCTTGGTAGGCGAGGGTGCAAAAAACCAGATTGCAATGAATCCTACTAACACAGTCTTCGATGTTAAGCGGCTTATTGGGAGTAGGTTCAGTGACCCACA...

Protein

Download Protein FASTA

512 aa · TkA05G035080|TK1151|PROTEIN

MSHKSKGAAIGIDLGTTYSCAGVWFHQKNRVEIIPNEQGNKVTPSFISFSDEEVLVGEGAKNQIAMNPTNTVFDVKRLIGSRFSDPQVQKDMKSWPFKVTEGPSEKPIIVVDVNGEEKKFAPEELSAMVLKKMKEAAESFIGKEVTDAVITVPAYFNNNQRESTKEAAIIAGLNVLRLINEPTAAAIAYGVEYTEGKKWENEKNVLVFDLGGGTFDVSLLTCGNTGAIDVKSVGGDTHLGGEDFDLTLVNHCMKEFKKKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G035080
TK1151 IDTkA05G035080
OH-1004 IDLXL04_021942
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)57.900
Protein coverage (%)TK1151 98.828 / OH-1004 19.542
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G035080
LocationChr05:9486792-9491757 (+)
DescriptionSimilar to HSP70-1: Heat shock 70 kDa protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g12580 In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).
Comprehensive expression profile analysis of the Arabidopsis Hsp70 gene family.2001 · DOI: 10.1104/pp.126.2.789
Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548
At5g02500 In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).
Physiological and molecular assessment of altered expression of Hsc70-1 in Arabidopsis. Evidence for pleiotropic consequences.2003 · DOI: 10.1104/pp.102.019398
Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses.2007 · DOI: 10.1105/tpc.107.051896
WPP-domain proteins mimic the activity of the HSC70-1 chaperone in preventing mistargeting of RanGAP1-anchoring protein WIT1.2009 · DOI: 10.1104/pp.109.143404
The cytosolic/nuclear HSC70 and HSP90 molecular chaperones are important for stomatal closure and modulate abscisic acid-dependent physiological responses in Arabidopsis.2011 · DOI: 10.1104/pp.111.174425

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021942 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006457 protein folding Biological Process
GO:0006950 response to stress Biological Process
GO:0009408 response to heat Biological Process
GO:0009615 response to virus Biological Process
GO:0009617 response to bacterium Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0010286 heat acclimation Biological Process
GO:0042026 protein refolding Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0090332 stomatal closure Biological Process
KEGG gene cross-reference
ath:AT5G02490
ath:AT5G02500
sly:101247772
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.646
Rank 1 · TkA05G035080 · TK1151
Nucleus0.242
Rank 2 · TkA05G035080 · TK1151
Mitochondrion0.130
Rank 3 · TkA05G035080 · TK1151
Cell membrane0.076
Rank 4 · TkA05G035080 · TK1151
Endoplasmic reticulum0.059
Rank 5 · TkA05G035080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP709-504 aa
PF06723MreB_Mbl9-20 aa
PF14450FtsA11-144 aa
PF01968Hydantoinase_A120-153 aa
PF06723MreB_Mbl130-391 aa
PF13941MutL180-225 aa
PF01968Hydantoinase_A188-225 aa
PF22128Alp7A_like_C205-225 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G035080PF00012HSP7095041.5e-177592.2
TkA05G035080PF06723MreB_Mbl9202.1e-1453.9
TkA05G035080PF14450FtsA111440.01316.6
TkA05G035080PF01968Hydantoinase_A1201530.06813.1
TkA05G035080PF06723MreB_Mbl1303912.1e-1453.9
TkA05G035080PF13941MutL1802250.02114.3
TkA05G035080PF01968Hydantoinase_A1882250.06813.1
TkA05G035080PF22128Alp7A_like_C2052250.2511.8
TkA05G035080PF14450FtsA2913740.01316.6
TkA05G035080PF22128Alp7A_like_C2922920.2511.8
TkA05G035080PF07318DUF14643123940.007416.2
TkA05G035080PF01968Hydantoinase_A3133660.06813.1
TkA05G035080PF23717DUF71593233890.01515.8
TkA05G035080PF02782FGGY_C3243890.0002921.5
TkA05G035080PF13941MutL3273700.02114.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LHA8Arabidopsis thalianasp|Q9LHA8|HS704_ARATH Heat shock 70 kDa protein 458.500%Swiss-ProtHigh
P22953Arabidopsis thalianasp|P22953|HS701_ARATH Heat shock 70 kDa protein 157.600%Swiss-ProtHigh

JBrowse

View in Genome Browser