TkA05G026700 | RubberDandelionOmics

Gene overview

TkA05G026700

Reference: TK1151 Chr: Chr05 Coordinates: 7259899-7261470 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1285 bp · TkA05G026700|TK1151|cDNA

CAAATAAAACCACAAGTAACTTGCCCATTACGACATAACTTCCTCTTCATCTCTTTTCAGTTTTCACTTCTCCTGCTCGTAGCCCTAGTTTCCCCTGCATCCTCGGCAAATACCAGGCATTTGGGCAAACACCAATCGAGTATTCGTTTTGATTCTAGCAGCTCGATCGGTCTATCACACACAAACATGGGCATAGATATCACCGGAAACGTACAAAAACCAAGATGGGGAGAGCTCGAAGAAGAGGATACAGATTATGA...

CDS

Download CDS FASTA

1062 bp · TkA05G026700|TK1151|CDS

CAAATAAAACCACAAGTAACTTGCCCATTACGACATAACTTCCTCTTCATCTCTTTTCAGTTTTCACTTCTCCTGCTCGTAGCCCTAGTTTCCCCTGCATCCTCGGCAAATACCAGGCATTTGGGCAAACACCAATCGAGTATTCGTTTTGATTCTAGCAGCTCGATCGGTCTATCACACACAAACATGGGCATAGATATCACCGGAAACGTACAAAAACCAAGATGGGGAGAGCTCGAAGAAGAGGATACAGATTATGA...

Protein

Download Protein FASTA

353 aa · TkA05G026700|TK1151|PROTEIN

QIKPQVTCPLRHNFLFISFQFSLLLLVALVSPASSANTRHLGKHQSSIRFDSSSSIGLSHTNMGIDITGNVQKPRWGELEEEDTDYDFLLPPKQVIGPDDHGLKKVVEYKFNDEGNRVKITTTTRVRKLANARLSKRAVERRSWPKFGDAVQEDVGARLTMVSTEEIIFERPRAPGTKAEDSNASGDPLAQMSKGGAVLMVCRTCGKKGDHWTSKCPYKDLAQPTESFTETPNPTDPSATGATKGAYVPPTMRPGAVRPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G026700`
TK1151 ID	TkA05G026700
OH-1004 ID	LXL04_019185
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 94.334 / OH-1004 49.405 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G026700`
Location	Chr05:7259899-7261470 (+)
Description	Similar to TBL34: Protein trichome birefringence-like 34
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0045492 xylan biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0016413 O-acetyltransferase activity Molecular Function GO:1990538 xylan O-acetyltransferase activity Molecular Function
KEGG gene cross-reference	ath:AT2G38320 ath:AT5G01620 dosa:Os03g0817500 dosa:Os11g0107000 osa:4349561 osa:4351267 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · TkA05G026700 · TK1151

Cytoplasm0.513

Rank 2 · TkA05G026700 · TK1151

Cell membrane0.060

Rank 3 · TkA05G026700 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA05G026700 · TK1151

Golgi apparatus0.047

Rank 5 · TkA05G026700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12353eIF3g94-221 aa

PF26602HVO_2718_N187-210 aa

PF16637zf-C2H2_assoc3196-236 aa

PF13696zf-CCHC_2201-217 aa

PF00076RRM_1274-340 aa

PF29396F07F6_N317-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G026700	`PF12353`	eIF3g	94	221	2.7e-33	115.7
TkA05G026700	`PF26602`	HVO_2718_N	187	210	0.098	12.9
TkA05G026700	`PF16637`	zf-C2H2_assoc3	196	236	0.27	12.4
TkA05G026700	`PF13696`	zf-CCHC_2	201	217	0.0027	18.2
TkA05G026700	`PF00076`	RRM_1	274	340	1.9e-17	63.6
TkA05G026700	`PF29396`	F07F6_N	317	349	0.088	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card