TkA05G026690 | RubberDandelionOmics

Gene overview

TkA05G026690

Reference: TK1151 Chr: Chr05 Coordinates: 7247680-7253727 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1271 bp · TkA05G026690|TK1151|cDNA

ATTTTGGCCGCCGTTCATAATTCAATAACTTGATTAGTTACAAATCTAGAAATTAAGCAAACCAATCCCATTTTCTACGTCTCTGTATCTCTCTATCCCATCTAAAAAGAGGGATGAGGAAGAAGAAGCTAGTGGTGGGGTCATGGGATGTGAAAAAGATGGTTAAGAGTAGTGTGATGATTATGTTGATGATTGGAGCATTAGTCACCATAGTTTTCTATTATGTCAACATCGACCATGAAGGAGAAAGTGGAGTAGTC...

CDS

Download CDS FASTA

1224 bp · TkA05G026690|TK1151|CDS

ATGAGGAAGAAGAAGCTAGTGGTGGGGTCATGGGATGTGAAAAAGATGGTTAAGAGTAGTGTGATGATTATGTTGATGATTGGAGCATTAGTCACCATAGTTTTCTATTATGTCAACATCGACCATGAAGGAGAAAGTGGAGTAGTCTACGATACCTCTGTTTACGATTCATTAGAAGCAGGGTGTGATTTGTTCTCTGGGAAATGGGTTCATGATAACGACTCATATCCTCTCTATAAAGACGTGGATTGCCCCTATCT...

Protein

Download Protein FASTA

407 aa · TkA05G026690|TK1151|PROTEIN

MRKKKLVVGSWDVKKMVKSSVMIMLMIGALVTIVFYYVNIDHEGESGVVYDTSVYDSLEAGCDLFSGKWVHDNDSYPLYKDVDCPYLFGDFACDRYGRMDSNYQQWRWQPHACNLPRFDAKEVLERLRGKRVVFVGDSVNRNQWASMVCMLQVAIPLGRKKMEKVHGVSLFTFKAFDYNVSIDFYWAPLLVESNGDHPSKHRTNERIVQIYSIEKHAKNWVNADVLVFNSYLWWRLPTVKIQTGPAEYNIVDNHNGYQMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G026690`
TK1151 ID	TkA05G026690
OH-1004 ID	LXL04_019185
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.300
Protein coverage (%)	TK1151 85.749 / OH-1004 51.935 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G026690

Location Chr05:7247680-7253727 (+)

Description Similar to TBL34: Protein trichome birefringence-like 34

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38320`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g01620`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g55990`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.2007 · DOI: 10.1111/j.1365-313x.2006.02994.x Metabolome and water status phenotyping of Arabidopsis under abiotic stress cues reveals new insight into ESK1 function.2009 · DOI: 10.1111/j.1365-3040.2008.01898.x ESKIMO1 is a key gene involved in water economy as well as cold acclimation and salt tolerance.2008 · DOI: 10.1186/1471-2229-8-125 ESKIMO1 disruption in Arabidopsis alters vascular tissue and impairs water transport.2011 · DOI: 10.1371/journal.pone.0016645 The Arabidopsis DUF231 domain-containing protein ESK1 mediates 2-O- and 3-O-acetylation of xylosyl residues in xylan.2013 · DOI: 10.1093/pcp/pct070 Molecular Mechanism of Polysaccharide Acetylation by the Arabidopsis Xylan O-acetyltransferase XOAT1.2020 · DOI: 10.1105/tpc.20.00028
`At2g40160`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0107000`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Two Trichome Birefringence-Like Proteins Mediate Xylan Acetylation, Which Is Essential for Leaf Blight Resistance in Rice.2017 · DOI: 10.1104/pp.16.01618
`Os03g0817500`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Biochemical characterization of rice xylan O-acetyltransferases.2018 · DOI: 10.1007/s00425-018-2882-1
`Os12g0106300`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Two Trichome Birefringence-Like Proteins Mediate Xylan Acetylation, Which Is Essential for Leaf Blight Resistance in Rice.2017 · DOI: 10.1104/pp.16.01618

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019185 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

GO:1990538 xylan O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38320

ath:AT5G01620

dosa:Os03g0817500

dosa:Os11g0107000

osa:4349561

osa:4351267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.704

Rank 1 · TkA05G026690 · TK1151

Endoplasmic reticulum0.073

Rank 2 · TkA05G026690 · TK1151

Cell membrane0.066

Rank 3 · TkA05G026690 · TK1151

Extracellular0.049

Rank 4 · TkA05G026690 · TK1151

Cytoplasm0.030

Rank 5 · TkA05G026690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416PMR5N61-114 aa

PF24536NXPE4_C108-187 aa

PF13839PC-Esterase115-400 aa

PF24536NXPE4_C323-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G026690	`PF14416`	PMR5N	61	114	1.3e-21	77.3
TkA05G026690	`PF24536`	NXPE4_C	108	187	0.00022	21.6
TkA05G026690	`PF13839`	PC-Esterase	115	400	2.9e-84	284.1
TkA05G026690	`PF24536`	NXPE4_C	323	369	0.00022	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80919`	Arabidopsis thaliana	sp\|O80919\|TBL34_ARATH Protein trichome birefringence-like 34	52.900%	Swiss-Prot	High
`Q8RXQ1`	Arabidopsis thaliana	sp\|Q8RXQ1\|TBL35_ARATH Protein trichome birefringence-like 35	48.800%	Swiss-Prot	Medium
`Q9LY46`	Arabidopsis thaliana	sp\|Q9LY46\|TBL29_ARATH Xylan O-acetyltransferase 1	53.400%	Swiss-Prot	Medium
`Q9SEZ9`	Arabidopsis thaliana	sp\|Q9SEZ9\|TBL30_ARATH Protein trichome birefringence-like 30	52.500%	Swiss-Prot	Medium
`Q2RBL8`	Oryza sativa subsp. japonica	sp\|Q2RBL8\|XOATC_ORYSJ Xylan O-acetyltransferase 12	50.300%	Swiss-Prot	High
`Q84TV3`	Oryza sativa subsp. japonica	sp\|Q84TV3\|XOATE_ORYSJ Xylan O-acetyltransferase 14	48.500%	Swiss-Prot	Medium
`Q2QYU2`	Oryza sativa subsp. japonica	sp\|Q2QYU2\|XOATD_ORYSJ Xylan O-acetyltransferase 13	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card