TkA05G026550 | RubberDandelionOmics

Gene overview

TkA05G026550

Reference: TK1151 Chr: Chr05 Coordinates: 7208479-7209995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA05G026550|TK1151|cDNA

ATACCGAAGATACGATCTGAGGGAATTTTGTACAACATCAATACCGAAGAATCCTCAATTGAGTTGTTTAACGTAAGATCATTTGGAACTGGAGGCCAGACAAAAGATGGTGCACAAATCATGCTCAATGAGAAAGTCTACAAATATAATATATTTTGTGGAATCAAATCAAGGATCCATAACGTGTTTTTGGGACTTACAATTGGTATCAGAGCTTGTAATTTTCAAAATCAATCATCAAGATTAAGCAAGAAGGTGGT...

CDS

Download CDS FASTA

357 bp · TkA05G026550|TK1151|CDS

ATACCGAAGATACGATCTGAGGGAATTTTGTACAACATCAATACCGAAGAATCCTCAATTGAGTTGTTTAACGTAAGATCATTTGGAACTGGAGGCCAGACAAAAGATGGTGCACAAATCATGCTCAATGAGAAAGTCTACAAATATAATATATTTTGTGGAATCAAATCAAGGATCCATAACGTGTTTTTGGGACTTACAATTGGTATCAGAGCTTGTAATTTTCAAAATCAATCATCAAGATTAAGCAAGAAGGTGGT...

Protein

Download Protein FASTA

118 aa · TkA05G026550|TK1151|PROTEIN

IPKIRSEGILYNINTEESSIELFNVRSFGTGGQTKDGAQIMLNEKVYKYNIFCGIKSRIHNVFLGLTIGIRACNFQNQSSRLSKKVVLSKDIRDLKRFVVCSVVAVLSDLPHQKRGFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G026550`
TK1151 ID	TkA05G026550
OH-1004 ID	LXL04_024542
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 33.051 / OH-1004 53.425 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G026550

Location Chr05:7208479-7209995 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26110`	As a component of the decapping complex, involved in the degradation of mRNAs.	Arabidopsis decapping 5 is required for mRNA decapping, P-body formation, and translational repression during postembryonic development.2009 · DOI: 10.1105/tpc.109.070078

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024542 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.345

Rank 1 · TkA05G026550 · TK1151

Cytoplasm0.248

Rank 2 · TkA05G026550 · TK1151

Plastid0.178

Rank 3 · TkA05G026550 · TK1151

Nucleus0.166

Rank 4 · TkA05G026550 · TK1151

Peroxisome0.051

Rank 5 · TkA05G026550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12701LSM143-54 aa

PF12701LSM1485-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G026550	`PF12701`	LSM14	3	54	1.4e-11	45.0
TkA05G026550	`PF12701`	LSM14	85	96	1.4e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C658`	Arabidopsis thaliana	sp\|Q9C658\|DCP5_ARATH Protein decapping 5	65.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card