TkA05G023520 | RubberDandelionOmics

Gene overview

TkA05G023520

Reference: TK1151 Chr: Chr05 Coordinates: 6389915-6394023 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1755 bp · TkA05G023520|TK1151|cDNA

CGCCGATCCCTCTCTAATTTTCTAACTAAATAACAAAGTTGACCTTCTGAAATACATATCGGAAGCCTTTACCTCAAACTCAACAGAACACCTTCGCAACCCTAAATCCTTACACGCCGTTTTCTTCTTCTCAGTGTTCGCCGGAGCAAGGCAGTGAGCTACAAAAGACGCAAAGCTTTCCGTTGGACCTTCGATACTCTTAAATTCCCTCCGTGACTCCGATAGTCTCCTCACAGCCTGTTTCGGCACCTGTTCCTCAT...

CDS

Download CDS FASTA

351 bp · TkA05G023520|TK1151|CDS

ATGGTCATTTGGAGCTTCCAGACACATCAAGATTCTCCCAACATTTTAGTTTATCGGATCTCTGGTAAAGCTCCTTTCAAAGTAGACATTGCTTTTGTAACTGGAATTGATATTGATGATGATGAAGTCCAAGAACGTGTCAACAGGCTCACTGGTACGTCATTGACTAGTCATCTTCATGAGAAGGAAAATGAATTTGATGATAAATTCAAGAAAATCTTTGATCCATCAGACAAGCTTGATTATGAATCTTTGGAAGT...

Protein

Download Protein FASTA

116 aa · TkA05G023520|TK1151|PROTEIN

MVIWSFQTHQDSPNILVYRISGKAPFKVDIAFVTGIDIDDDEVQERVNRLTGTSLTSHLHEKENEFDDKFKKIFDPSDKLDYESLEVGKAAIGNLLGAIRHFYGLSKILYPQPSKG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G023520`
TK1151 ID	TkA05G023520
OH-1004 ID	LXL04_038585
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G023520

Location Chr05:6389915-6394023 (+)

Description Similar to GCS1: Mannosyl-oligosaccharide glucosidase GCS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24320`	Alpha-glucosidase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0004558 alpha-1,4-glucosidase activity Molecular Function

GO:0004573 Glc3Man9GlcNAc2 oligosaccharide glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24320

ath:AT1G67490

mmu:57377

rno:78947

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.470

Rank 1 · TkA05G023520 · TK1151

Cytoplasm0.426

Rank 2 · TkA05G023520 · TK1151

Mitochondrion0.093

Rank 3 · TkA05G023520 · TK1151

Cell membrane0.062

Rank 4 · TkA05G023520 · TK1151

Extracellular0.059

Rank 5 · TkA05G023520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20667Sec10_N41-96 aa

PF03200Glyco_hydro_6350-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G023520	`PF20667`	Sec10_N	41	96	0.12	13.2
TkA05G023520	`PF03200`	Glyco_hydro_63	50	110	5.1e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M89`	Arabidopsis thaliana	sp\|Q84M89\|GCS2_ARATH Alpha-glucosidase 2	50.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card