TkA05G020250 | RubberDandelionOmics

Gene overview

TkA05G020250

Reference: TK1151 Chr: Chr05 Coordinates: 5530162-5531271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA05G020250|TK1151|cDNA

ATGTATCGTTGGAGTCATAAATCAGTCAAGGAAAGCAAATCCCGGAAAAACACACAAAACCCATCTTTTTCCTCAACCCTTCTCGATGAAATCTACCGTTCTATGGACGGGGACGATGAGAAATTAGGCCGAGAAGAGAAGTTCCCAAAGAAACAGACCACCACCAGCGGCGGTGGCAGACCAAAGGCGAGCAGTGCGGTGGAGGACGAAGGAGTGGCGAGTTTCCGGCGAGCTTTTCTGGTCGAGAAATGGATGGACAT...

CDS

Download CDS FASTA

1026 bp · TkA05G020250|TK1151|CDS

ATGTATCGTTGGAGTCATAAATCAGTCAAGGAAAGCAAATCCCGGAAAAACACACAAAACCCATCTTTTTCCTCAACCCTTCTCGATGAAATCTACCGTTCTATGGACGGGGACGATGAGAAATTAGGCCGAGAAGAGAAGTTCCCAAAGAAACAGACCACCACCAGCGGCGGTGGCAGACCAAAGGCGAGCAGTGCGGTGGAGGACGAAGGAGTGGCGAGTTTCCGGCGAGCTTTTCTGGTCGAGAAATGGATGGACAT...

Protein

Download Protein FASTA

341 aa · TkA05G020250|TK1151|PROTEIN

MYRWSHKSVKESKSRKNTQNPSFSSTLLDEIYRSMDGDDEKLGREEKFPKKQTTTSGGGRPKASSAVEDEGVASFRRAFLVEKWMDMKAINSKNMSRRTKPSSLPDLDQKPVVDNDQFFISSGFHNSRCHKPSCFGPFRRPEPVKTNAFSKKHQQMELCYCSDDHQTNVIDNIYANLKKLKQPISPGGRLTTFLNSLLVNGHVKKPKDLNPPCFDHKKIERTSKSTCSSASSFTRSCLSKNSPRSREKLNNGVRRTVRFY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G020250`
TK1151 ID	TkA05G020250
OH-1004 ID	LXL04_019117
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G020250

Location Chr05:5530162-5531271 (+)

Description Similar to At1g54200: Protein BIG GRAIN 1-like B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13980`	Involved in auxin transport.	No verified direct reference in this release
`At1g54200`	Involved in auxin transport.	No verified direct reference in this release
`At3g42800`	Involved in auxin transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8APC7`	Involved in auxin transport.	No verified direct reference in this release
`Os03g0175800`	Involved in auxin transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019117 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0060918 auxin transport Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G54200

ath:AT3G13980

ath:AT3G42800

dosa:Os03g0175800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.495

Rank 1 · TkA05G020250 · TK1151

Nucleus0.378

Rank 2 · TkA05G020250 · TK1151

Cytoplasm0.321

Rank 3 · TkA05G020250 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA05G020250 · TK1151

Plastid0.028

Rank 5 · TkA05G020250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30505Big_grain_11-43 aa

PF30505Big_grain_1139-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G020250	`PF30505`	Big_grain_1	1	43	3.7e-31	109.7
TkA05G020250	`PF30505`	Big_grain_1	139	336	3.7e-31	109.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVK2`	Arabidopsis thaliana	sp\|Q9LVK2\|BIG1A_ARATH Protein BIG GRAIN 1-like A	31.700%	Swiss-Prot	Medium
`Q9SLL2`	Arabidopsis thaliana	sp\|Q9SLL2\|BIG1B_ARATH Protein BIG GRAIN 1-like B	30.600%	Swiss-Prot	Medium
`Q9M2B3`	Arabidopsis thaliana	sp\|Q9M2B3\|BIG1C_ARATH Protein BIG GRAIN 1-like C	33.300%	Swiss-Prot	Medium
`B8APC7`	Oryza sativa subsp. indica	sp\|B8APC7\|BG1_ORYSI Protein BIG GRAIN 1	28.700%	Swiss-Prot	Low
`Q10R09`	Oryza sativa subsp. japonica	sp\|Q10R09\|BG1_ORYSJ Protein BIG GRAIN 1	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card