TkA05G016530 | RubberDandelionOmics

Gene overview

TkA05G016530

Reference: TK1151 Chr: Chr05 Coordinates: 4652508-4654357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1378 bp · TkA05G016530|TK1151|cDNA

ATGTCGAATTTTATCAATCCCAAAATTGGCAGCGGTCCACCTCCTAAACCATGGGAACGAGCCGGATCATCATCTGGTCCTGCCCCTTTCAAACCCGCTACACCAGGTAGCACAAGTGACGTAGTCGAAGCTTCAGGAACAGCAAGACCAGGTGAAATCGTTCAATCAAACAATACAACTTCAGCAGTCAACACCCTCGGGAGACCTGTACCCCCAAGACCATGGGAACAACAACAAACCTACGGAGGTGCGGGTTACGG...

CDS

Download CDS FASTA

888 bp · TkA05G016530|TK1151|CDS

ATGTCGAATTTTATCAATCCCAAAATTGGCAGCGGTCCACCTCCTAAACCATGGGAACGAGCCGGATCATCATCTGGTCCTGCCCCTTTCAAACCCGCTACACCAGGTAGCACAAGTGACGTAGTCGAAGCTTCAGGAACAGCAAGACCAGGTGAAATCGTTCAATCAAACAATACAACTTCAGCAGTCAACACCCTCGGGAGACCTGTACCCCCAAGACCATGGGAACAACAACAAACCTACGGAGGTGCGGGTTACGG...

Protein

Download Protein FASTA

295 aa · TkA05G016530|TK1151|PROTEIN

MSNFINPKIGSGPPPKPWERAGSSSGPAPFKPATPGSTSDVVEASGTARPGEIVQSNNTTSAVNTLGRPVPPRPWEQQQTYGGAGYGSTLGYNSGGYGTAGGYGSYGGMSSYNSGGLYGNSMYRGGGGYGGLYGGGSSMYGGGMYGSSYGGGMGGMGMGMGGMGMGMGMGGPGGPYDDQDPNNPFGAPSQPPGFWISLMRVMQGFVTFFGRVAMLIDQNAQAFHMFMSALLQLFDRSGLLYGELARFVFRILGVRTKGNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G016530`
TK1151 ID	TkA05G016530
OH-1004 ID	LXL04_019074
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G016530

Location Chr05:4652508-4654357 (-)

Description Similar to PEX13: Peroxisomal membrane protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07560`	Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor.	The Arabidopsis pex12 and pex13 mutants are defective in both PTS1- and PTS2-dependent protein transport to peroxisomes.2006 · DOI: 10.1111/j.1365-313x.2006.02809.x Functional classification of Arabidopsis peroxisome biogenesis factors proposed from analyses of knockdown mutants.2007 · DOI: 10.1093/pcp/pcm053 Molecular components required for the targeting of PEX7 to peroxisomes in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03970.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019074 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016560 protein import into peroxisome matrix, docking Biological Process

GO:0005778 peroxisomal membrane Cellular Component

GO:1990429 peroxisomal importomer complex Cellular Component

KEGG gene cross-reference

ath:AT3G07560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.531

Rank 1 · TkA05G016530 · TK1151

Cytoplasm0.281

Rank 2 · TkA05G016530 · TK1151

Nucleus0.156

Rank 3 · TkA05G016530 · TK1151

Mitochondrion0.150

Rank 4 · TkA05G016530 · TK1151

Endoplasmic reticulum0.150

Rank 5 · TkA05G016530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRR0`	Arabidopsis thaliana	sp\|Q9SRR0\|PEX13_ARATH Peroxisomal membrane protein 13	60.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card