TkA05G015400 | RubberDandelionOmics

Gene overview

TkA05G015400

Reference: TK1151 Chr: Chr05 Coordinates: 4356581-4356992 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA05G015400|TK1151|cDNA

CTTGATTTACAACGCGAATACGAAGAATGTATCCAAGCAGGGGGAACTCCAAATGAGGTCGCAATATTTAGAAAAGTGTTAGGTCCTCGTCGTGGGCATATCAAAGGCATCGGTCCTCAAGTTTCACAAGTCTCATCTCGATCTTTTGATAAAGGACAATCGTCATCAACGTCAAAATCTCGACATAAAAAGAAAGATGTGGTTGATAAGATTGCTGAAAACCCTTCTTTGAGAGCTAAATTCCTAAAATTCCTACGCAC...

CDS

Download CDS FASTA

348 bp · TkA05G015400|TK1151|CDS

CTTGATTTACAACGCGAATACGAAGAATGTATCCAAGCAGGGGGAACTCCAAATGAGGTCGCAATATTTAGAAAAGTGTTAGGTCCTCGTCGTGGGCATATCAAAGGCATCGGTCCTCAAGTTTCACAAGTCTCATCTCGATCTTTTGATAAAGGACAATCGTCATCAACGTCAAAATCTCGACATAAAAAGAAAGATGTGGTTGATAAGATTGCTGAAAACCCTTCTTTGAGAGCTAAATTCCTAAAATTCCTACGCAC...

Protein

Download Protein FASTA

115 aa · TkA05G015400|TK1151|PROTEIN

LDLQREYEECIQAGGTPNEVAIFRKVLGPRRGHIKGIGPQVSQVSSRSFDKGQSSSTSKSRHKKKDVVDKIAENPSLRAKFLKFLRTVNTQENDDDDDDEDEDEDEDEDQDEDLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G015400`
TK1151 ID	TkA05G015400
OH-1004 ID	LXL04_029742
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 81.739 / OH-1004 3.645 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G015400`
Location	Chr05:4356581-4356992 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029742` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA05G015400 · TK1151

Cytoplasm0.221

Rank 2 · TkA05G015400 · TK1151

Mitochondrion0.021

Rank 3 · TkA05G015400 · TK1151

Cell membrane0.015

Rank 4 · TkA05G015400 · TK1151

Extracellular0.009

Rank 5 · TkA05G015400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07543PGA239-107 aa

PF06524NOA3644-112 aa

PF24181TPR_TTI1_C49-111 aa

PF04889Cwf_Cwc_1554-112 aa

PF20480DUF672054-109 aa

PF04931DNA_pol_phi54-115 aa

PF11705RNA_pol_3_Rpc3157-113 aa

PF29351Acidic_SOMP86-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G015400	`PF07543`	PGA2	39	107	0.02	15.6
TkA05G015400	`PF06524`	NOA36	44	112	0.0045	17.1
TkA05G015400	`PF24181`	TPR_TTI1_C	49	111	3.1	8.1
TkA05G015400	`PF04889`	Cwf_Cwc_15	54	112	0.064	13.8
TkA05G015400	`PF20480`	DUF6720	54	109	3.9	7.4
TkA05G015400	`PF04931`	DNA_pol_phi	54	115	9.8	4.9
TkA05G015400	`PF11705`	RNA_pol_3_Rpc31	57	113	0.024	15.4
TkA05G015400	`PF29351`	Acidic_SOMP	86	111	2.9	7.6
TkA05G015400	`PF05086`	Dicty_REP	89	113	0.053	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card