TkA05G015370 | RubberDandelionOmics

Gene overview

TkA05G015370

Reference: TK1151 Chr: Chr05 Coordinates: 4350628-4352453 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

803 bp · TkA05G015370|TK1151|cDNA

AGTCGAAATCGAGTATTTCACGAGCCGGTTTTGAGATTCTCGAAATTGATGCAGTCGTGGGTGATTCAACAATCTTGGCCAACAGATCCGAGTATGTTGACTTTACAGCGACTTACACAGATTTGGGTGTAGGAACACTAGTAAGAAACAAGAAAAGGGACATGTGGTTCTTCTTGAAGCCGCTTGACTTGCGTCTATGGCTAACTGCTATTGCTGCTCTTATCTTTACTGCCTTAATTGTTTGGGCTATTGAATGTATG...

CDS

Download CDS FASTA

801 bp · TkA05G015370|TK1151|CDS

TCGAAATCGAGTATTTCACGAGCCGGTTTTGAGATTCTCGAAATTGATGCAGTCGTGGGTGATTCAACAATCTTGGCCAACAGATCCGAGTATGTTGACTTTACAGCGACTTACACAGATTTGGGTGTAGGAACACTAGTAAGAAACAAGAAAAGGGACATGTGGTTCTTCTTGAAGCCGCTTGACTTGCGTCTATGGCTAACTGCTATTGCTGCTCTTATCTTTACTGCCTTAATTGTTTGGGCTATTGAATGTATGAA...

Protein

Download Protein FASTA

266 aa · TkA05G015370|TK1151|PROTEIN

SKSSISRAGFEILEIDAVVGDSTILANRSEYVDFTATYTDLGVGTLVRNKKRDMWFFLKPLDLRLWLTAIAALIFTALIVWAIECMNPDPELNQGIGTVFWLILSTIFFAQRDKLSSNLSKFVMFIWLLVVLVLLTSYTATLASLLTVEQFESASKGGIVGFHGDGDVDAIVDEIPYIKMFLSRNYGDYALLSSQPITSGFAFIFRKGSPLVEDVSREIARIRLDGTLASLENNWFNNRLSILSRNSTMPRALKLDRFGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G015370`
TK1151 ID	TkA05G015370
OH-1004 ID	LXL04_019060
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 98.120 / OH-1004 67.095 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G015370

Location Chr05:4350628-4352453 (+)

Description Similar to GLR1.4: Glutamate receptor 1.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48400`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At3g07520`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
`At5g48410`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At3g04110`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	The putative glutamate receptor 1.1 (AtGLR1.1) functions as a regulator of carbon and nitrogen metabolism in Arabidopsis thaliana.2003 · DOI: 10.1073/pnas.1030961100 The putative glutamate receptor 1.1 (AtGLR1.1) in Arabidopsis thaliana regulates abscisic acid biosynthesis and signaling to control development and water loss.2004 · DOI: 10.1093/pcp/pch159 Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
`At2g29120`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019060 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004930 G protein-coupled receptor activity Molecular Function

KEGG gene cross-reference

ath:AT3G04110

ath:AT3G07520

ath:AT5G11210

ath:AT5G48400

ath:AT5G48410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.635

Rank 1 · TkA05G015370 · TK1151

Lysosome / Vacuole0.130

Rank 2 · TkA05G015370 · TK1151

Endoplasmic reticulum0.105

Rank 3 · TkA05G015370 · TK1151

Cytoplasm0.070

Rank 4 · TkA05G015370 · TK1151

Golgi apparatus0.039

Rank 5 · TkA05G015370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00497SBP_bac_314-237 aa

PF10613Lig_chan-Glu_bd14-50 aa

PF00060Lig_chan63-153 aa

PF14118YfzA63-134 aa

PF26161DUF804466-82 aa

PF14296O-ag_pol_Wzy97-137 aa

PF26161DUF804497-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G015370	`PF00497`	SBP_bac_3	14	237	7.2e-11	42.7
TkA05G015370	`PF10613`	Lig_chan-Glu_bd	14	50	0.00054	20.8
TkA05G015370	`PF00060`	Lig_chan	63	153	2e-18	67.3
TkA05G015370	`PF14118`	YfzA	63	134	0.61	11.3
TkA05G015370	`PF26161`	DUF8044	66	82	0.38	11.5
TkA05G015370	`PF14296`	O-ag_pol_Wzy	97	137	0.056	12.9
TkA05G015370	`PF26161`	DUF8044	97	141	0.38	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV72`	Arabidopsis thaliana	sp\|Q9LV72\|GLR12_ARATH Glutamate receptor 1.2	38.400%	Swiss-Prot	Medium
`Q8LGN1`	Arabidopsis thaliana	sp\|Q8LGN1\|GLR14_ARATH Glutamate receptor 1.4	37.200%	Swiss-Prot	Medium
`Q9FH75`	Arabidopsis thaliana	sp\|Q9FH75\|GLR13_ARATH Glutamate receptor 1.3	37.700%	Swiss-Prot	Medium
`Q9M8W7`	Arabidopsis thaliana	sp\|Q9M8W7\|GLR11_ARATH Glutamate receptor 1.1	36.600%	Swiss-Prot	Medium
`Q8LGN0`	Arabidopsis thaliana	sp\|Q8LGN0\|GLR27_ARATH Glutamate receptor 2.7	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card