RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G013050
Reference: TK1151 Chr: Chr05 Coordinates: 3720568-3724278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3501 bp · TkA05G013050|TK1151|cDNA

TTGATTCTAGAAACAGCATCTAGATACATGGACAACTTAAGGGGCCAATTTTGTAATATCAATCTTTATAATTATCTAAATGCTGAACGACGAATTTGAGAGTCAAACTAATATATTTGCTTTCAAACCTCTGCAACTATCCTTATCCTACATGCCACCACCACCATAACCAACCACCTTCCTCCACCGTGCCGTCAAACCAATATGCCAATACTACCCTTACCTTCTCTCCTCCTCCTCTTTTTCCTCCTACCCTTTCA...

CDS

Download CDS FASTA

3006 bp · TkA05G013050|TK1151|CDS

ATGCCAATACTACCCTTACCTTCTCTCCTCCTCCTCTTTTTCCTCCTACCCTTTCACGTAATTTCACAATCCACCACCACCCAAAATGACCAAAACATTCTTCTCAACATCAAAAGCTTCTGGTCCAATCCGCCTTCCCTCAACCACTGGAACCAATCCTCCGACCCTTGCAGCTGGCCGGAGATTACATGTACCGGGACCACCATCACCGGCATCACCGTCGTTGATCAGGACATCAGCGGTACTGTTCCACCGTTCAT...

Protein

Download Protein FASTA

1001 aa · TkA05G013050|TK1151|PROTEIN

MPILPLPSLLLLFFLLPFHVISQSTTTQNDQNILLNIKSFWSNPPSLNHWNQSSDPCSWPEITCTGTTITGITVVDQDISGTVPPFICDLKNLTVLDLNYNDITGNFPAALYNCTNLRYLDLSQNYFVGKIPDDISRLSPELRYLSLFGNNFSGDIPASISRLSKLSSLQLHQTLLNGSFPQEIGYLNDLEELNLSFNKFTPSRLPPSFTQLKRLRKFYMTEANLIGEIPGNFSGMPAMEILDLSFNRLNGSIPRDLFLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G013050
TK1151 IDTkA05G013050
OH-1004 IDLXL04_019040
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G013050
LocationChr05:3720568-3724278 (+)
DescriptionSimilar to HSL1: Receptor-like protein kinase HSL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g28650 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
At4g28490 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission. No verified direct reference in this release
At5g65710 Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission. No verified direct reference in this release
At1g28440 Receptor-like protein kinase HSL1. No verified direct reference in this release
At1g09970 Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).
RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4
The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019040 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0010102 lateral root morphogenesis Biological Process
GO:0010227 floral organ abscission Biological Process
GO:0010468 regulation of gene expression Biological Process
GO:0030154 cell differentiation Biological Process
GO:0045490 pectin catabolic process Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0050829 defense response to Gram-negative bacterium Biological Process
GO:0051707 response to other organism Biological Process
GO:0060866 leaf abscission Biological Process
GO:0140547 acquisition of seed longevity Biological Process
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G28440
ath:AT4G28490
ath:AT5G65710
gmx:732661
mtr:11439632
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884
Rank 1 · TkA05G013050 · TK1151
Endoplasmic reticulum0.077
Rank 2 · TkA05G013050 · TK1151
Cytoplasm0.060
Rank 3 · TkA05G013050 · TK1151
Nucleus0.037
Rank 4 · TkA05G013050 · TK1151
Lysosome / Vacuole0.025
Rank 5 · TkA05G013050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09716ETRAMP9-32 aa
PF08263LRRNT_229-65 aa
PF23598LRR_1473-219 aa
PF25013LRR_Zer-185-101 aa
PF13855LRR_889-126 aa
PF29252LRR_NLRC489-127 aa
PF12799LRR_491-132 aa
PF13516LRR_691-105 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G013050PF09716ETRAMP9320.02615.2
TkA05G013050PF08263LRRNT_229652.3e-0731.7
TkA05G013050PF23598LRR_14732192.9e-2692.8
TkA05G013050PF25013LRR_Zer-1851018.1e-0626.7
TkA05G013050PF13855LRR_8891267.9e-37125.6
TkA05G013050PF29252LRR_NLRC4891270.01815.0
TkA05G013050PF12799LRR_4911326.7e-31106.3
TkA05G013050PF13516LRR_6911052.7e-0937.1
TkA05G013050PF00560LRR_1921143.7e-49154.8
TkA05G013050PF24758LRR_At5g56370921724.5e-0523.9
TkA05G013050PF29247LRR_MHP1-HER1-GIP3981261.09.2
TkA05G013050PF25013LRR_Zer-11111908.1e-0626.7
TkA05G013050PF13516LRR_61131252.7e-0937.1
TkA05G013050PF29594LRR_SKP21152030.0002521.1
TkA05G013050PF00560LRR_11161383.7e-49154.8
TkA05G013050PF13855LRR_81402007.9e-37125.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M0G7Arabidopsis thalianasp|Q9M0G7|MIK1_ARATH MDIS1-interacting receptor like kinase 142.800%Swiss-ProtLow
P47735Arabidopsis thalianasp|P47735|RLK5_ARATH Receptor-like protein kinase 542.600%Swiss-ProtLow
C0LGX3Arabidopsis thalianasp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL240.200%Swiss-ProtLow
Q9SGP2Arabidopsis thalianasp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL140.100%Swiss-ProtLow
F4I2N7Arabidopsis thalianasp|F4I2N7|RLK7_ARATH Receptor-like protein kinase 740.800%Swiss-ProtLow

JBrowse

View in Genome Browser