TkA05G012760 | RubberDandelionOmics

Gene overview

TkA05G012760

Reference: TK1151 Chr: Chr05 Coordinates: 3632166-3638221 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3778 bp · TkA05G012760|TK1151|cDNA

AATTAGTTTGTTTAGTGTGAATATACCATACTTTTAATGATTCCACCACTAAATTTTTAGTGGTGGGTACTCGGTTTAACAGTACCCCTAAAAGAATTATAATTCAATTTCAAAATGACACACTTATTGAAAAGTGCAAACACATTCACAGCGCGAACTTCCACACGCTACTCTGCGAACCTTCGTCCTCCTTAACTCACCACGTATCGCTTCACCGGCGACGGTGATCATACTACTTTGAAAGCAAGACACAGTTACGA...

CDS

Download CDS FASTA

1728 bp · TkA05G012760|TK1151|CDS

ATGAAAGATAAAAGTTATGAGAAGTTTGACCTTGTCAAACCTGAGATTGGATCAACAGGTCTTGGAGGTGGGGATGTGCTAGTCAAGGATCCGCCTTTGTTGATCCAATGTCGGTTATATAATAAGGGTCTTGCAGTAAAAGGAACTCTTCTAGTCAATAAGAGGCTTAACCCAAGAACAATTCAGGTCAGACCATCAATGATTAAGGTTAAGCAAGATCCAAGATTTTCAGATAAAGAATCATTTAATTCTCTGGAAGT...

Protein

Download Protein FASTA

575 aa · TkA05G012760|TK1151|PROTEIN

MKDKSYEKFDLVKPEIGSTGLGGGDVLVKDPPLLIQCRLYNKGLAVKGTLLVNKRLNPRTIQVRPSMIKVKQDPRFSDKESFNSLEVVAVSHKPKAAKLSKHLIALLSIGGVPKSYFLGLLETTLKDTQRVCSDPRAAFRVANIYQQIDDSGMCIEMFGARIPLNEPYFQYRLSQLSKEERKGLGDGKIPISDSFYLMGTTDPTGILNPNEVCIILENGQISGKVLVYRNPGLHFGDIHVLNARYVKELEDYIGNGKFAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G012760`
TK1151 ID	TkA05G012760
OH-1004 ID	LXL04_019033
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 53.191 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G012760

Location Chr05:3632166-3638221 (+)

Description Similar to RDR3: Probable RNA-dependent RNA polymerase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19930`	Probably involved in the RNA silencing pathway and required for the generation of small interfering RNAs (siRNAs).	No verified direct reference in this release
`At2g19910`	Probably involved in the RNA silencing pathway and required for the generation of small interfering RNAs (siRNAs).	No verified direct reference in this release
`At2g19920`	Probably involved in the RNA silencing pathway and required for the generation of small interfering RNAs (siRNAs).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0197900`	Probably involved in the RNA silencing pathway and required for the generation of small interfering RNAs (siRNAs).	No verified direct reference in this release
`Os01g0198000`	Probably involved in the RNA silencing pathway and required for the generation of small interfering RNAs (siRNAs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019033 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030422 siRNA processing Biological Process

GO:0009507 chloroplast Cellular Component

GO:0031380 nuclear RNA-directed RNA polymerase complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003968 RNA-directed RNA polymerase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19910

ath:AT2G19920

ath:AT2G19930

dosa:Os01g0197900

dosa:Os01g0198000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.685

Rank 1 · TkA05G012760 · TK1151

Cytoplasm0.348

Rank 2 · TkA05G012760 · TK1151

Mitochondrion0.049

Rank 3 · TkA05G012760 · TK1151

Cell membrane0.038

Rank 4 · TkA05G012760 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA05G012760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05183RdRP29-427 aa

PF26839DUF8272452-471 aa

PF26253RdRP_head476-555 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G012760	`PF05183`	RdRP	29	427	2.7e-79	268.1
TkA05G012760	`PF26839`	DUF8272	452	471	0.038	14.9
TkA05G012760	`PF26253`	RdRP_head	476	555	3.2e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82188`	Arabidopsis thaliana	sp\|O82188\|RDR5_ARATH Probable RNA-dependent RNA polymerase 5	52.300%	Swiss-Prot	High
`O82190`	Arabidopsis thaliana	sp\|O82190\|RDR3_ARATH Probable RNA-dependent RNA polymerase 3	49.400%	Swiss-Prot	Medium
`O82189`	Arabidopsis thaliana	sp\|O82189\|RDR4_ARATH Probable RNA-dependent RNA polymerase 4	48.900%	Swiss-Prot	Medium
`Q5QMN5`	Oryza sativa subsp. japonica	sp\|Q5QMN5\|RDR3_ORYSJ Probable RNA-dependent RNA polymerase 3	46.100%	Swiss-Prot	Medium
`Q5QMN4`	Oryza sativa subsp. japonica	sp\|Q5QMN4\|RDR4_ORYSJ Probable RNA-dependent RNA polymerase 4	45.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card