TkA05G011440 | RubberDandelionOmics

Gene overview

TkA05G011440

Reference: TK1151 Chr: Chr05 Coordinates: 3272769-3273900 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · TkA05G011440|TK1151|cDNA

ATGAGAAACTTCCAGGCTTTGTTTGCAATTGTATTTATCTCAGTAATTGCATTCCAATCATGTCTTGTCCATGGAAACTTTTACAGGGACGTGTACTTCAACTGGGGTGCCAAGCAATCATACATTTATGGCAATGGTGATGATCTTAATCTGGTTCTTAATCATGTTTCAGGATCTGGTGTTCAATCACACAGTGCGTACCTTTTTGGAAGCATTGAAATGCTAATTAAGTTGGTTCCAGGGAACTCTGCTGGAACTGT...

CDS

Download CDS FASTA

834 bp · TkA05G011440|TK1151|CDS

ATGAGAAACTTCCAGGCTTTGTTTGCAATTGTATTTATCTCAGTAATTGCATTCCAATCATGTCTTGTCCATGGAAACTTTTACAGGGACGTGTACTTCAACTGGGGTGCCAAGCAATCATACATTTATGGCAATGGTGATGATCTTAATCTGGTTCTTAATCATGTTTCAGGATCTGGTGTTCAATCACACAGTGCGTACCTTTTTGGAAGCATTGAAATGCTAATTAAGTTGGTTCCAGGGAACTCTGCTGGAACTGT...

Protein

Download Protein FASTA

277 aa · TkA05G011440|TK1151|PROTEIN

MRNFQALFAIVFISVIAFQSCLVHGNFYRDVYFNWGAKQSYIYGNGDDLNLVLNHVSGSGVQSHSAYLFGSIEMLIKLVPGNSAGTVTAYYLSSTGDYHDEIDFEFLGNSSGEPYTMHTNIFTQGKGNREQQFKLWFDPTADFHNYTIHWNPTAVVWYVDSIPIRVYRNYMHEGIGFPNQQGMQVYSSLWNADNWATRGGLVKIDWSCAPFMAGLRKFSCAFPTPANWWTSPAYKQLSWEQQGKLKWVRDNYMIYNYCTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G011440`
TK1151 ID	TkA05G011440
OH-1004 ID	LXL04_019014
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G011440

Location Chr05:3272769-3273900 (+)

Description Similar to XTH26: Probable xyloglucan endotransglucosylase/hydrolase protein 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28850`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g25820`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	In vitro activities of four xyloglucan endotransglycosylases from Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00459.x
`At4g25810`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019014 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0070726 cell wall assembly Biological Process

GO:0071456 cellular response to hypoxia Biological Process

KEGG gene cross-reference

ath:AT4G25810

ath:AT4G28850

ath:AT5G57560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.345

Rank 1 · TkA05G011440 · TK1151

Extracellular0.321

Rank 2 · TkA05G011440 · TK1151

Cytoplasm0.176

Rank 3 · TkA05G011440 · TK1151

Endoplasmic reticulum0.159

Rank 4 · TkA05G011440 · TK1151

Golgi apparatus0.111

Rank 5 · TkA05G011440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722Glyco_hydro_1631-207 aa

PF06955XET_C225-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G011440	`PF00722`	Glyco_hydro_16	31	207	3.6e-60	203.1
TkA05G011440	`PF06955`	XET_C	225	272	5.1e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVV2`	Arabidopsis thaliana	sp\|Q9SVV2\|XTH26_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 26	56.300%	Swiss-Prot	High
`Q9ZSU4`	Arabidopsis thaliana	sp\|Q9ZSU4\|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14	55.800%	Swiss-Prot	High
`Q38910`	Arabidopsis thaliana	sp\|Q38910\|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card