TkA05G005760 | RubberDandelionOmics

Gene overview

TkA05G005760

Reference: TK1151 Chr: Chr05 Coordinates: 1744356-1751969 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · TkA05G005760|TK1151|cDNA

AGTCTGTGGGTTAATATTAGTCGAGCGGTAGCCAAACTAAAAGTAAAAGGAATTGACTTGTCCGAGTTGTGTGTTTTAAAAGTGGGAGATGGAACACGAACAAGGTTTTGGCTGAATCATTGGATTGGCAGGCGGCCTTTAGCCGAAGAGGTTCTGCATTTGTTTGTTCAGGATTCTGAGTCGGAGGTTGCTGTTTGTCGGCGTAACACAGTTGAGAAGATTTTTGGAGATTTTGTGGTGGAGCCGCGAAGAGATATCCC...

CDS

Download CDS FASTA

918 bp · TkA05G005760|TK1151|CDS

AGTCTGTGGGTTAATATTAGTCGAGCGGTAGCCAAACTAAAAGTAAAAGGAATTGACTTGTCCGAGTTGTGTGTTTTAAAAGTGGGAGATGGAACACGAACAAGGTTTTGGCTGAATCATTGGATTGGCAGGCGGCCTTTAGCCGAAGAGGTTCTGCATTTGTTTGTTCAGGATTCTGAGTCGGAGGTTGCTGTTTGTCGGCGTAACACAGTTGAGAAGATTTTTGGAGATTTTGTGGTGGAGCCGCGAAGAGATATCCC...

Protein

Download Protein FASTA

305 aa · TkA05G005760|TK1151|PROTEIN

SLWVNISRAVAKLKVKGIDLSELCVLKVGDGTRTRFWLNHWIGRRPLAEEVLHLFVQDSESEVAVCRRNTVEKIFGDFVVEPRRDIPTAQWVHLQSLIHDFVFHDVPNRYEWWLGSSEDYSVASARQHIDSVLLGDSGVTTRWNSLVPKKLNILMWCVVRDQIPTRLNLRDRGIDLHFVLCLVCEVIGESTSHLFVSCLAFSPIWNRIALWWGVATSSVLSVDALVRWADEVTLNREAKAAFDAVVIVAFWIIWSFQNKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G005760`
TK1151 ID	TkA05G005760
OH-1004 ID	LXL04_010120
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.600
Protein coverage (%)	TK1151 77.049 / OH-1004 16.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G005760`
Location	Chr05:1744356-1751969 (-)
Description	Similar to ENT3: Equilibrative nucleotide transporter 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010120` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015858 nucleoside transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005337 nucleoside transmembrane transporter activity Molecular Function
KEGG gene cross-reference	ath:AT4G05110 ath:AT4G05120 ath:AT4G05140 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · TkA05G005760 · TK1151

Nucleus0.251

Rank 2 · TkA05G005760 · TK1151

Cell membrane0.152

Rank 3 · TkA05G005760 · TK1151

Golgi apparatus0.091

Rank 4 · TkA05G005760 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkA05G005760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT48-57 aa

PF13966zf-RVT133-205 aa

PF02887PK_C135-249 aa

PF11131PhrC_PhrF192-204 aa

PF13966zf-RVT210-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G005760	`PF13966`	zf-RVT	48	57	1.3e-12	48.9
TkA05G005760	`PF13966`	zf-RVT	133	205	1.3e-12	48.9
TkA05G005760	`PF02887`	PK_C	135	249	0.33	11.8
TkA05G005760	`PF11131`	PhrC_PhrF	192	204	0.3	11.4
TkA05G005760	`PF13966`	zf-RVT	210	229	1.3e-12	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card