TkA05G005220 | RubberDandelionOmics

Gene overview

TkA05G005220

Reference: TK1151 Chr: Chr05 Coordinates: 1542875-1546441 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · TkA05G005220|TK1151|cDNA

CAATACTGAAAGCAAAGCAAAGCGCTGCACTCGTTTCGTTTCGTAAATGGAAAATGAATTAGAAACCATGACTGTTGTTTTCTGTTAGAAACTACATCGGAATCGCAATCCTGAAACCCTCCAACATTCCTTGCTGGAAGAAGACTCCGTTTTTCTTTTCAGCGAGCTCTGTAATTCATTTCCTGGGTTGAAGCTTTATAGGCTCCATGGCGAGGATTAAACCCCAAGCTCTGCTACAGCAAAGCAAAAAGAAGAAAGCA...

CDS

Download CDS FASTA

705 bp · TkA05G005220|TK1151|CDS

ATGGCGAGGATTAAACCCCAAGCTCTGCTACAGCAAAGCAAAAAGAAGAAAGCACCCAGAAGTATCAGTATTCCCACAATTGCGTTGTACAGCGTAGTTACTGTTGTTATGGTGTTTTTCCTGTTTGCTACTTACAGACACTGGTCTCAAAGGTCAGTATTGCAGATAGAGGAGGGAACATCAAACTTTCAGGTGGAAGATGACTTTTCAGATTCAAAGAAGTCTGACGTTCCTAGATATGCTATTTTTAACACGTCAAA...

Protein

Download Protein FASTA

234 aa · TkA05G005220|TK1151|PROTEIN

MARIKPQALLQQSKKKKAPRSISIPTIALYSVVTVVMVFFLFATYRHWSQRSVLQIEEGTSNFQVEDDFSDSKKSDVPRYAIFNTSKGLITVELYKEGSPEVVDEFIDACQKGHFKGMLFQRVVKHFVIQGGDSENHAVIEDWTSREKHYNQLEKRLKHEAFMLGTSNVKQEKSGFDIFITTAPIPDLNAKLNVFGRVIKGEDIVQEIEEVDTDEHYRPKSRIGIIDVTLKHNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G005220`
TK1151 ID	TkA05G005220
OH-1004 ID	LXL04_018951
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G005220

Location Chr05:1542875-1546441 (+)

Description Similar to CYP21-4: Peptidyl-prolyl cis-trans isomerase CYP21-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g66654`	PPIases accelerate the folding of proteins.	No verified direct reference in this release
`At2g47320`	PPIases accelerate the folding of proteins.	No verified direct reference in this release
`At3g44600`	PPIases accelerate the folding of proteins (Probable).	A WD40 domain cyclophilin interacts with histone H3 and functions in gene repression and organogenesis in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053579 Structural and functional analyses of the PPIase domain of Arabidopsis thaliana CYP71 reveal its catalytic activity toward histone H3.2021 · DOI: 10.1002/1873-3468.13965
`At2g36130`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018951 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006457 protein folding Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010338 leaf formation Biological Process

GO:0010358 leaf shaping Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0048440 carpel development Biological Process

KEGG gene cross-reference

ath:AT2G36130

ath:AT2G47320

ath:AT3G44600

ath:AT3G66654

cnb:CNBC5760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.556

Rank 1 · TkA05G005220 · TK1151

Endoplasmic reticulum0.296

Rank 2 · TkA05G005220 · TK1151

Cytoplasm0.093

Rank 3 · TkA05G005220 · TK1151

Nucleus0.067

Rank 4 · TkA05G005220 · TK1151

Cell membrane0.053

Rank 5 · TkA05G005220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05751FixH16-49 aa

PF26566PH_4026-80 aa

PF15957Comm26-83 aa

PF00160Pro_isomerase82-229 aa

PF05751FixH133-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G005220	`PF05751`	FixH	16	49	0.05	14.3
TkA05G005220	`PF26566`	PH_40	26	80	0.0053	17.5
TkA05G005220	`PF15957`	Comm	26	83	0.17	12.8
TkA05G005220	`PF00160`	Pro_isomerase	82	229	1.4e-32	113.9
TkA05G005220	`PF05751`	FixH	133	219	0.05	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C835`	Arabidopsis thaliana	sp\|Q9C835\|CP21D_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-4	59.200%	Swiss-Prot	High
`Q94A16`	Arabidopsis thaliana	sp\|Q94A16\|CP21C_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial	52.600%	Swiss-Prot	High
`Q8W4D0`	Arabidopsis thaliana	sp\|Q8W4D0\|CPY71_ARATH Peptidyl-prolyl cis-trans isomerase CYP71	33.100%	Swiss-Prot	Medium
`Q9SIH1`	Arabidopsis thaliana	sp\|Q9SIH1\|CP18B_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-2	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card