TkA05G005200 | RubberDandelionOmics

Gene overview

TkA05G005200

Reference: TK1151 Chr: Chr05 Coordinates: 1536441-1541517 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

872 bp · TkA05G005200|TK1151|cDNA

TGGTATATCCATTTAGTAAAAATAATGGCGACATTTCTACCTCTCGCCTTCCACTGTGTCTCTCAGAATCCGCTGTGCAAGTGCAAACCACAATTCCTGTCCACCAACAACAATCGCTCCTTCCGTCTATGTGCTCAATCAAGAGAAACTATAGAAAAGACGATAGAGTACAGGCCTGGCCTCTTGGATGAGGTATTCCTGAATTTGTTCCGCAAGAAGATGGTGCAGGAAGTTGGATGGGATTCGGAGAAAGCAGGTTA...

CDS

Download CDS FASTA

804 bp · TkA05G005200|TK1151|CDS

ATGGCGACATTTCTACCTCTCGCCTTCCACTGTGTCTCTCAGAATCCGCTGTGCAAGTGCAAACCACAATTCCTGTCCACCAACAACAATCGCTCCTTCCGTCTATGTGCTCAATCAAGAGAAACTATAGAAAAGACGATAGAGTACAGGCCTGGCCTCTTGGATGAGGTATTCCTGAATTTGTTCCGCAAGAAGATGGTGCAGGAAGTTGGATGGGATTCGGAGAAAGCAGGTTACGATGGACTAATCGACGTTGCCAA...

Protein

Download Protein FASTA

267 aa · TkA05G005200|TK1151|PROTEIN

MATFLPLAFHCVSQNPLCKCKPQFLSTNNNRSFRLCAQSRETIEKTIEYRPGLLDEVFLNLFRKKMVQEVGWDSEKAGYDGLIDVANRLMVARSNSETQEAAVRILRSLFPPLLLELYKILIAPIAQGKVAAVMVARVTAVSCQWLMGSCRVNSVDVADGSSLGSGVFVERCKYLEESKCVGICVNTCKLPTQKFFMDQMGVPLLMEPNFNDYSCQFKFGVCPPPEEEDSSLKEGCLEACPNAIRRLTTPSIGTKCPKVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G005200`
TK1151 ID	TkA05G005200
OH-1004 ID	LXL04_029451
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.000
Protein coverage (%)	TK1151 71.161 / OH-1004 72.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G005200

Location Chr05:1536441-1541517 (+)

Description Similar to D27: Beta-carotene isomerase D27, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03055`	Involved in strigolactones biosynthesis by catalyzing the isomerization of the C9-C10 double bond in all-trans-beta-carotene leading to 9-cis-beta-carotene and providing the substrate for CCD7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029451 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010223 secondary shoot formation Biological Process

GO:1901601 strigolactone biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016859 cis-trans isomerase activity Molecular Function

GO:0106365 beta-carotene isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03055

mtr:25485781

osa:107276001

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.957

Rank 1 · TkA05G005200 · TK1151

Mitochondrion0.037

Rank 2 · TkA05G005200 · TK1151

Nucleus0.026

Rank 3 · TkA05G005200 · TK1151

Cytoplasm0.021

Rank 4 · TkA05G005200 · TK1151

Cell membrane0.018

Rank 5 · TkA05G005200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13225D27-like_C145-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G005200	`PF13225`	D27-like_C	145	228	1.4e-35	121.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA78`	Arabidopsis thaliana	sp\|Q7XA78\|D27_ARATH Beta-carotene isomerase D27, chloroplastic	32.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card