TkA05G004660 | RubberDandelionOmics

Gene overview

TkA05G004660

Reference: TK1151 Chr: Chr05 Coordinates: 1371547-1371858 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA05G004660|TK1151|cDNA

ATGTGTGGAGGTGACCGACTTTCTCAAAAACTCAAATTACCAAAAAGCCATCTCCAAGCAATCACATTACACCGTGACATTGTCCCCAGAGCTTTTTCCTGTAAATACCCGAGCCGTGTAGCCGAGCTTTTAAAAGCGGTTAACGGGAATTTCCGAAATCACCCCTGTTTAAATAACCAGAATTTATTATACGCACCAATGGGGGAGTTTCTGATTCTTCAACCGGATTCAAAACTGTCGCCAAACCATGACCTTCTTCC...

CDS

Download CDS FASTA

312 bp · TkA05G004660|TK1151|CDS

ATGTGTGGAGGTGACCGACTTTCTCAAAAACTCAAATTACCAAAAAGCCATCTCCAAGCAATCACATTACACCGTGACATTGTCCCCAGAGCTTTTTCCTGTAAATACCCGAGCCGTGTAGCCGAGCTTTTAAAAGCGGTTAACGGGAATTTCCGAAATCACCCCTGTTTAAATAACCAGAATTTATTATACGCACCAATGGGGGAGTTTCTGATTCTTCAACCGGATTCAAAACTGTCGCCAAACCATGACCTTCTTCC...

Protein

Download Protein FASTA

103 aa · TkA05G004660|TK1151|PROTEIN

MCGGDRLSQKLKLPKSHLQAITLHRDIVPRAFSCKYPSRVAELLKAVNGNFRNHPCLNNQNLLYAPMGEFLILQPDSKLSPNHDLLPSGSGLYVLRAARAMMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G004660`
TK1151 ID	TkA05G004660
OH-1004 ID	LXL04_018933
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 92.233 / OH-1004 13.343 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G004660

Location Chr05:1371547-1371858 (+)

Description Similar to PLIP2: Phospholipase A1 PLIP2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02660`	Sn-1-specific phospholipase A1 that catalyzes the initial step of oxylipins and jasmonate (JA) biosynthesis.	Two Abscisic Acid-Responsive Plastid Lipase Genes Involved in Jasmonic Acid Biosynthesis in <i>Arabidopsis thaliana</i>.2018 · DOI: 10.1105/tpc.18.00250
`At3g62590`	Sn-1-specific phospholipase A1 that catalyzes the initial step of oxylipins and jasmonate (JA) biosynthesis.	Two Abscisic Acid-Responsive Plastid Lipase Genes Involved in Jasmonic Acid Biosynthesis in <i>Arabidopsis thaliana</i>.2018 · DOI: 10.1105/tpc.18.00250
`At3g61680`	Sn-1-specific phospholipase A1 involved in seed oil biosynthesis.	A Plastid Phosphatidylglycerol Lipase Contributes to the Export of Acyl Groups from Plastids for Seed Oil Biosynthesis.2017 · DOI: 10.1105/tpc.17.00397

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004806 triacylglycerol lipase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02660

ath:AT3G61680

ath:AT3G62590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkA05G004660 · TK1151

Nucleus0.320

Rank 2 · TkA05G004660 · TK1151

Mitochondrion0.268

Rank 3 · TkA05G004660 · TK1151

Cell membrane0.084

Rank 4 · TkA05G004660 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA05G004660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HXL0`	Arabidopsis thaliana	sp\|F4HXL0\|PLIP2_ARATH Phospholipase A1 PLIP2, chloroplastic	75.800%	Swiss-Prot	High
`Q940L4`	Arabidopsis thaliana	sp\|Q940L4\|PLIP3_ARATH Phospholipase A1 PLIP3, chloroplastic	75.800%	Swiss-Prot	High
`Q7Y220`	Arabidopsis thaliana	sp\|Q7Y220\|PLIP1_ARATH Phospholipase A1 PLIP1, chloroplastic	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card