TkA05G004610 | RubberDandelionOmics

Gene overview

TkA05G004610

Reference: TK1151 Chr: Chr05 Coordinates: 1356234-1358919 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

464 bp · TkA05G004610|TK1151|cDNA

AAACGAGATACTTTTGACTAGGAAAAATGTCGTCAACGGTGATAGCAGCGGAGACGGACGAACGGAGTCCTCTTCTTCAAAATTCGTCTCAGTTTGTTGGTGAGAATGAGATCACTCCTTTTGCTTCACTGTCACCGGACAATAATGATGAACGTTCTTCTGCTACTAAGCCTACCGATCCTAAACAACGCCTCGTCTCCCTCGACGTTTTCCGTGGTCTCACCGTCGCCTTGATGATATTGGTTGATGACGCGGGAGGA...

CDS

Download CDS FASTA

1461 bp · TkA05G004610|TK1151|CDS

ATGTCGTCAACGGTGATAGCAGCGGAGACGGACGAACGGAGTCCTCTTCTTCAAAATTCGTCTCAGTTTGTTGGTGAGAATGAGATCACTCCTTTTGCTTCACTGTCACCGGACAATAATGATGAACGTTCTTCTGCTACTAAGCCTACCGATCCTAAACAACGCCTCGTCTCCCTCGACGTTTTCCGTGGTCTCACCGTCGCCTTGATGATATTGGTTGATGACGCGGGAGGAGCTTTCCCTTCGATTAACCATTCTCC...

Protein

Download Protein FASTA

486 aa · TkA05G004610|TK1151|PROTEIN

MSSTVIAAETDERSPLLQNSSQFVGENEITPFASLSPDNNDERSSATKPTDPKQRLVSLDVFRGLTVALMILVDDAGGAFPSINHSPWFGVTLADFVMPFFLFSVGISISLVFKKVSSKPAATKKVVLRSIKLFLLGLILQGGYFHGRDDLTYGVDVNQIRWMGVLQRISIGYLFASVTEIWCVNNNEVNSAIAFVKKYYIQWLFVLVLCVLYMSLLYGVYVPDWSFQVINQNFSLSVPQTQTVKCGVKGSLEPPCNAVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G004610`
TK1151 ID	TkA05G004610
OH-1004 ID	LXL04_018931
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G004610`
Location	Chr05:1356234-1358919 (+)
Description	Similar to Hgsnat: Heparan-alpha-glucosaminide N-acetyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018931` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007041 lysosomal transport Biological Process GO:0030200 heparan sulfate proteoglycan catabolic process Biological Process GO:0051259 protein complex oligomerization Biological Process GO:0005765 lysosomal membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0043202 lysosomal lumen Cellular Component GO:0070821 tertiary granule membrane Cellular Component GO:0015019 heparan-alpha-glucosaminide N-acetyltransferase activity Molecular Function GO:0016746 acyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:138050 mmu:52120 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.308

Rank 1 · TkA05G004610 · TK1151

Lysosome / Vacuole0.262

Rank 2 · TkA05G004610 · TK1151

Endoplasmic reticulum0.227

Rank 3 · TkA05G004610 · TK1151

Cytoplasm0.199

Rank 4 · TkA05G004610 · TK1151

Cell membrane0.135

Rank 5 · TkA05G004610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07786HGSNAT_cat55-201 aa

PF16401DUF500989-136 aa

PF16401DUF5009188-210 aa

PF16401DUF5009342-369 aa

PF07786HGSNAT_cat380-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G004610	`PF07786`	HGSNAT_cat	55	201	2.7e-06	27.8
TkA05G004610	`PF16401`	DUF5009	89	136	0.0036	17.5
TkA05G004610	`PF16401`	DUF5009	188	210	0.0036	17.5
TkA05G004610	`PF16401`	DUF5009	342	369	0.0036	17.5
TkA05G004610	`PF07786`	HGSNAT_cat	380	416	2.7e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card