TkA05G004280 | RubberDandelionOmics

Gene overview

TkA05G004280

Reference: TK1151 Chr: Chr05 Coordinates: 1286043-1287267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1045 bp · TkA05G004280|TK1151|cDNA

AGTGACTCGAGAGGGGCACCGTAGTAATTAAGCCATAAATGTAGAGGTGGCTAGGGTTTGTGTCCCGCCGACCAGCGCCTCCCACGCATTTCCACTTCCCAAATTTTGTTTTTGAATTTTTTTTTTCTTTTTGTTTTCTTCTCTTCAGTCAAAGTCATAGCTCAAAGGCTGCACATATAATACAAGCAACGTACTTCAATATCTGATCCTCAGCCCTCATCTATGCTCGCCATTATCACGCTCACAGATTTTCAATCCAA...

CDS

Download CDS FASTA

342 bp · TkA05G004280|TK1151|CDS

ATGCTGTACGAGTGTCAAACTACTAGAACGCCTCTTTGGAGAGGCGGACCTGCTGGTCCCAAGTCGCTTTGCAATGCGTGTGGTATCAAATACAACAAGAAGAGGAGGACACAAGTTAGTGGATTTGATAAAAGCGGAAGAACATCGAAATGTGCGAAACGAGACGGAGATTTGAATTTGAAAGTCCGATTGATGGTGATAAATAAAAAAAAACAAAAGCAGCATCAGAGAAAGCGATCGTCTTACGAAAGAGGGAAGCC...

Protein

Download Protein FASTA

113 aa · TkA05G004280|TK1151|PROTEIN

MLYECQTTRTPLWRGGPAGPKSLCNACGIKYNKKRRTQVSGFDKSGRTSKCAKRDGDLNLKVRLMVINKKKQKQHQRKRSSYERGKPWWNNLREEEQAAILLMAISCGGSLYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G004280`
TK1151 ID	TkA05G004280
OH-1004 ID	LXL04_018921
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.600
Protein coverage (%)	TK1151 97.345 / OH-1004 40.520 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G004280

Location Chr05:1286043-1287267 (-)

Description Similar to GATA15: GATA transcription factor 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06740`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g26930`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g16870`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g49300`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0220400`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters (By similarity).	Rice cytokinin GATA transcription Factor1 regulates chloroplast development and plant architecture.2013 · DOI: 10.1104/pp.113.217265

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018921 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G06740

ath:AT3G16870

ath:AT5G26930

ath:AT5G49300

ath:AT5G56860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA05G004280 · TK1151

Cytoplasm0.086

Rank 2 · TkA05G004280 · TK1151

Cell membrane0.021

Rank 3 · TkA05G004280 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA05G004280 · TK1151

Plastid0.009

Rank 5 · TkA05G004280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00320GATA4-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G004280	`PF00320`	GATA	4	36	1.9e-14	53.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LG10`	Arabidopsis thaliana	sp\|Q8LG10\|GAT15_ARATH GATA transcription factor 15	48.600%	Swiss-Prot	Medium
`Q8LC59`	Arabidopsis thaliana	sp\|Q8LC59\|GAT23_ARATH GATA transcription factor 23	66.700%	Swiss-Prot	Low
`Q9LIB5`	Arabidopsis thaliana	sp\|Q9LIB5\|GAT17_ARATH GATA transcription factor 17	58.700%	Swiss-Prot	Medium
`Q9FJ10`	Arabidopsis thaliana	sp\|Q9FJ10\|GAT16_ARATH GATA transcription factor 16	39.600%	Swiss-Prot	Medium
`Q6YW48`	Oryza sativa subsp. japonica	sp\|Q6YW48\|CGA1_ORYSJ Protein CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR 1	60.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card