TkA05G002460 | RubberDandelionOmics

Gene overview

TkA05G002460

Reference: TK1151 Chr: Chr05 Coordinates: 746895-747993 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkA05G002460|TK1151|cDNA

ATGTTGGTTTCATGGGTTACTAAGATGGTTGAAGCTCCGAAGACCGATGTTGAATTTTGGAAAACTCTGTTTCCGGTGGCATTAGCACATACAATTGAACACGCGGCAGCTACAACCAGTATGTCAAAAGTTGCGGGTTCATTTACACACATTATTAAAAGCACCGAACCTGCTTTTAGTGTATTGGTTTCAAGGTTCTTTCTTAGTGAAACATTCCTAATTGGGGTTTATTTGTCACTTTTGCCAATCATTGGGGGTTG...

CDS

Download CDS FASTA

306 bp · TkA05G002460|TK1151|CDS

ATGTTGGTTTCATGGGTTACTAAGATGGTTGAAGCTCCGAAGACCGATGTTGAATTTTGGAAAACTCTGTTTCCGGTGGCATTAGCACATACAATTGAACACGCGGCAGCTACAACCAGTATGTCAAAAGTTGCGGGTTCATTTACACACATTATTAAAAGCACCGAACCTGCTTTTAGTGTATTGGTTTCAAGGTTCTTTCTTAGTGAAACATTCCTAATTGGGGTTTATTTGTCACTTTTGCCAATCATTGGGGGTTG...

Protein

Download Protein FASTA

101 aa · TkA05G002460|TK1151|PROTEIN

MLVSWVTKMVEAPKTDVEFWKTLFPVALAHTIEHAAATTSMSKVAGSFTHIIKSTEPAFSVLVSRFFLSETFLIGVYLSLLPIIGGCGPSAFTELNFNMTG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G002460`
TK1151 ID	TkA05G002460
OH-1004 ID	LXL04_018879
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 69.178 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G002460

Location Chr05:746895-747993 (+)

Description Similar to GPT2: Glucose-6-phosphate/phosphate translocator 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61800`	Glucose 6-phosphate (Glc6P) transporter.	The Arabidopsis plastidic glucose 6-phosphate/phosphate translocator GPT1 is essential for pollen maturation and embryo sac development.2005 · DOI: 10.1105/tpc.104.029124 Dynamic acclimation of photosynthesis increases plant fitness in changing environments.2010 · DOI: 10.1104/pp.109.149351 The role of plastidial glucose-6-phosphate/phosphate translocators in vegetative tissues of Arabidopsis thaliana mutants impaired in starch biosynthesis.2010 · DOI: 10.1111/j.1438-8677.2010.00349.x GPT2: a glucose 6-phosphate/phosphate translocator with a novel role in the regulation of sugar signalling during seedling development.2014 · DOI: 10.1093/aob/mct298 Acclimation of metabolism to light in Arabidopsis thaliana: the glucose 6-phosphate/phosphate translocator GPT2 directs metabolic acclimation.2015 · DOI: 10.1111/pce.12495
`At5g54800`	Glucose 6-phosphate (Glc6P) transporter.	The Arabidopsis plastidic glucose 6-phosphate/phosphate translocator GPT1 is essential for pollen maturation and embryo sac development.2005 · DOI: 10.1105/tpc.104.029124 The plastidial glucose-6-phosphate/phosphate antiporter GPT1 is essential for morphogenesis in Arabidopsis embryos.2010 · DOI: 10.1111/j.1365-313x.2010.04313.x The Arabidopsis Plastidial Glucose-6-Phosphate Transporter GPT1 is Dually Targeted to Peroxisomes via the Endoplasmic Reticulum.2020 · DOI: 10.1105/tpc.19.00959
`At5g17630`	Sugar phosphate/phosphate translocator that transports inorganic phosphate, triose phosphate, 3-phosphoglycerate, xylulose 5-phosphate (Xul-5-P) and to a lesser extent ribulose 5-phosphate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0172100`	Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018879 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007033 vacuole organization Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009624 response to nematode Biological Process

GO:0009643 photosynthetic acclimation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010152 pollen maturation Biological Process

GO:0015713 phosphoglycerate transmembrane transport Biological Process

GO:0015714 phosphoenolpyruvate transport Biological Process

GO:0015760 glucose-6-phosphate transport Biological Process

KEGG gene cross-reference

ath:AT1G61800

ath:AT5G17630

ath:AT5G54800

dosa:Os01g0172100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.380

Rank 1 · TkA05G002460 · TK1151

Golgi apparatus0.184

Rank 2 · TkA05G002460 · TK1151

Cell membrane0.119

Rank 3 · TkA05G002460 · TK1151

Plastid0.097

Rank 4 · TkA05G002460 · TK1151

Cytoplasm0.061

Rank 5 · TkA05G002460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151TPT1-101 aa

PF00892EamA3-87 aa

PF07942CARME3-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G002460	`PF03151`	TPT	1	101	2.9e-32	113.0
TkA05G002460	`PF00892`	EamA	3	87	3e-05	25.0
TkA05G002460	`PF07942`	CARME	3	69	0.031	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B38`	Arabidopsis thaliana	sp\|Q94B38\|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic	78.200%	Swiss-Prot	High
`Q9M5A9`	Arabidopsis thaliana	sp\|Q9M5A9\|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic	76.200%	Swiss-Prot	High
`Q9LF61`	Arabidopsis thaliana	sp\|Q9LF61\|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic	48.500%	Swiss-Prot	Medium
`Q5VQL3`	Oryza sativa subsp. japonica	sp\|Q5VQL3\|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card