Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1212 bp · TkA05G002430|TK1151|cDNA
CACAATGCCCTTTCAATTAATAAAACCCTACAAACACAACAAAAACAATCGCCCCGACTTTTTCTTCCTCTGCGATTCTTCCTCGCTGCTTCTTCTGCGTCGCGACCTCCACACAGCCACTGCACTATCTCGGCCGACATCCAGGTTCCGGTGTAATGCATGAAAAATGGGGGCTTGAAAAAAACTAGTTGCGCATCCGGGGAATCGAACCCCGGTCAGTACCGTGGGAGGGTACTATGATACCACTACACTAGATGCGC...
699 bp · TkA05G002430|TK1151|CDS
ATGAGGATAATTGGATTGACCGGAGGAATTGCAACGGGGAAGAGTACTGTATCTAATCTCTTCAAAGCTAACGGATTTCCTGTCGTCGATGCCGATGTCATCGCCCGTGACGTATTAAAGAAAGGTACTGGTGGTTGGAGAAAGGTAGTTGCAGCTTTTGGGGATGACATACTGCTAGAAAATGGGGAAGTTGATAGGCCAAAATTGGGCCAAATTGTATTCACTGATCCATCAAAACGCCAGCTTCTTAATAGGCTTCT...
Protein
Download Protein FASTA232 aa · TkA05G002430|TK1151|PROTEIN
MRIIGLTGGIATGKSTVSNLFKANGFPVVDADVIARDVLKKGTGGWRKVVAAFGDDILLENGEVDRPKLGQIVFTDPSKRQLLNRLLSSYISYGILWEVFKLWIKGYKIIILDVPLLFEAKMDTWTNPTIVVYIDPETQLQRLMTRDRTSTQDAQNRINAQMPLDEKRSRADIVIDNNGSLEDLNENFRKVLNQVTKPLTWTEFWLSRQGAIVAIVSIFSGVFGCKKLLARL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G002430 |
|---|---|
| TK1151 ID | TkA05G002430 |
| OH-1004 ID | LXL04_018877 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G002430 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:734179-736177 (+) | ||||||||||||
| Description | Similar to COAE: Dephospho-CoA kinase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0015937 coenzyme A biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005773 vacuole Cellular Component GO:0005777 peroxisome Cellular Component GO:0009507 chloroplast Cellular Component GO:0004140 dephospho-CoA kinase activity Molecular Function GO:0005524 ATP binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G27490 dosa:Os01g0360600 lin:lin1598 mmu:68087 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01121CoaE3-182 aaPF13238AAA_184-154 aaPF03266NTPase_14-74 aaPF13521AAA_285-53 aaPF01712dNK6-30 aaPF00625Guanylate_kin77-193 aaPF01712dNK120-153 aaPF29206Tp0624_N125-197 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G002430 | PF01121 | CoaE | 3 | 182 | 2.8e-58 | 197.3 |
| TkA05G002430 | PF13238 | AAA_18 | 4 | 154 | 3e-05 | 25.2 |
| TkA05G002430 | PF03266 | NTPase_1 | 4 | 74 | 0.056 | 14.0 |
| TkA05G002430 | PF13521 | AAA_28 | 5 | 53 | 0.0038 | 18.2 |
| TkA05G002430 | PF01712 | dNK | 6 | 30 | 0.015 | 15.8 |
| TkA05G002430 | PF00625 | Guanylate_kin | 77 | 193 | 0.00052 | 20.5 |
| TkA05G002430 | PF01712 | dNK | 120 | 153 | 0.015 | 15.8 |
| TkA05G002430 | PF29206 | Tp0624_N | 125 | 197 | 0.031 | 15.5 |
| TkA05G002430 | PF13521 | AAA_28 | 147 | 163 | 0.0038 | 18.2 |
| TkA05G002430 | PF03266 | NTPase_1 | 164 | 197 | 0.056 | 14.0 |
| TkA05G002430 | PF01121 | CoaE | 186 | 201 | 2.8e-58 | 197.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.