TkA05G001390 | RubberDandelionOmics

Gene overview

TkA05G001390

Reference: TK1151 Chr: Chr05 Coordinates: 395733-402701 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2913 bp · TkA05G001390|TK1151|cDNA

ATCATGGTTCAAAATTAATTTCGTATTAAACATTAATTTGCACCGCCGTATACGGTCAACATAGTTTTTTTAAAGTGCGCCAACAAATTCATTTCTCCGGCGATAATCTGCTAAAAATAGTACAGAGACACACCATCGGTGCAGCCTCCTTCCGATATGCATTTAAATAAGATTGTTTAGGGCTCAAAAACCTTCTATCGGTTCTTCTGTGTTCAAGTGCAATCCTCTGCGTAGTTGTTGTTCTGGTTCAGGAAAGCAAA...

CDS

Download CDS FASTA

2361 bp · TkA05G001390|TK1151|CDS

ATGCGGCCTGCGAAGGAGGATGCACCATGCAAGGCGAAACAAGCGGTCGATTTAGTTTCAGCTATCAAAGAGTTACATTCACTAAGTTCTCAAGAACTTAGCAAGTTAATCAGAGATGCAGACAATGATACTATTCAATGGACTACAAGTGATGGATCATCAAATCAGATTGATGTGGAAAACCTAGCAAGAAACTTTGCAGTTCACCTAATTGCAAAACTTATGTCATCTAAAAGAGATGAAGAACTCTTCAGATACTT...

Protein

Download Protein FASTA

786 aa · TkA05G001390|TK1151|PROTEIN

MRPAKEDAPCKAKQAVDLVSAIKELHSLSSQELSKLIRDADNDTIQWTTSDGSSNQIDVENLARNFAVHLIAKLMSSKRDEELFRYLLAGLRLLHGLCDQATRNSKLEQVLLDDMKVSEQMFDLIFYMITVLASFKKESPLALVHSALLACSLYLLTAFISSQWHELALVLLAHPKVDIFMPVAFAAVHIDIQFLQVKLSEFTDTGTQSNLAEVNRLCQHCEASLQFLQSLCQQRFFRERLVKNKELCGEGGILLLAHDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G001390`
TK1151 ID	TkA05G001390
OH-1004 ID	LXL04_018853
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G001390

Location Chr05:395733-402701 (-)

Description Similar to NDX: Nodulin homeobox

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03090`	Regulates COOLAIR, a set of antisense transcripts originating from the 3' end of FLOWERING LOCUS C (FLC).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018853 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0048364 root development Biological Process

GO:0060195 negative regulation of antisense RNA transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G03090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · TkA05G001390 · TK1151

Cytoplasm0.233

Rank 2 · TkA05G001390 · TK1151

Cell membrane0.042

Rank 3 · TkA05G001390 · TK1151

Endoplasmic reticulum0.031

Rank 4 · TkA05G001390 · TK1151

Golgi apparatus0.028

Rank 5 · TkA05G001390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25246Nodulin_N14-517 aa

PF00046Homeodomain639-699 aa

PF24426HTH_NDX645-707 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G001390	`PF25246`	Nodulin_N	14	517	8.2e-221	734.6
TkA05G001390	`PF00046`	Homeodomain	639	699	0.049	14.2
TkA05G001390	`PF24426`	HTH_NDX	645	707	2e-34	118.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JI44`	Arabidopsis thaliana	sp\|F4JI44\|NDX_ARATH Nodulin homeobox	40.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card