Gene Card
Gene overview
cDNA / CDS / Protein Sequences
745 bp · TkA05G000760|TK1151|cDNA
CACCTATACATACAGATCGCTGTAAGCAATTCTCGTTCTCTCCATCTCTTTCATCGTCCCTCCTCTGTTTATTTCTCTAAATCTCCACAAGCTTTTTCGCCGGAGTTGAGTATCAATTACCGACTAGCCGTCGTTTTAATTTATCCTATCGGAAAACGCCTAATAGTTTCATTTTGTAAGAGAGAGGATGGCGCCGGCATCCGGCGTTTCTTCATCATTAGATCGCGTCCCAACGATGGTGCCTGTACAGCCGGGAATGA...
1593 bp · TkA05G000760|TK1151|CDS
ATGGCGCCGGCATCCGGCGTTTCTTCATCATTAGATCGCGTCCCAACGATGGTGCCTGTACAGCCGGGAATGATGATGCCTGGTGCGTTTGCGAAGGACGCAATTATCTCGTGGTTCAGAGGAGAGTTCGCGGCAGCGAACGCAATCATTGACGCTCTGTGCGGCCACCTGTCGCAATTAGAAGGCGGAAGATGTGAGTACGAGACTGTCTTCGCTGCTATACACCGGCGTAGACTAAATTGGATCCCAATTCTACAGAT...
Protein
Download Protein FASTA530 aa · TkA05G000760|TK1151|PROTEIN
MAPASGVSSSLDRVPTMVPVQPGMMMPGAFAKDAIISWFRGEFAAANAIIDALCGHLSQLEGGRCEYETVFAAIHRRRLNWIPILQMQKYFSIADVTAELQKVIEEKTRLGGIDKLEEINVSSPVKEKNLEITLECTDSNGNGDAEAVDEDFSRDDSPNSDITDTGSQEVHLLAENNNEIISSKQEQDWESRRAQIKLTKGFVAKESVKGHMVNVVRGLKLYEDILNDTEILKLNEYVSELRVAGQNGQLSGETFIKYNQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G000760 |
|---|---|
| TK1151 ID | TkA05G000760 |
| OH-1004 ID | LXL04_018842 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G000760 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:216074-222228 (+) | |||||||||
| Description | Similar to ALKBH10B: RNA demethylase ALKBH10B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006402 mRNA catabolic process Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0070988 demethylation Biological Process GO:0000932 P-body Cellular Component GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0003729 mRNA binding Molecular Function GO:0032451 demethylase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:1990931 mRNA N6-methyladenosine dioxygenase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G17970 ath:AT4G02940 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27981ALKBH10B_N32-108 aaPF135322OG-FeII_Oxy_2283-391 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G000760 | PF27981 | ALKBH10B_N | 32 | 108 | 9.7e-41 | 138.8 |
| TkA05G000760 | PF13532 | 2OG-FeII_Oxy_2 | 283 | 391 | 0.032 | 15.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.