TkA05G000580 | RubberDandelionOmics

Gene overview

TkA05G000580

Reference: TK1151 Chr: Chr05 Coordinates: 145688-146189 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA05G000580|TK1151|cDNA

ATGTGTTTGCAGGAAATTGACCTGAAGAATCATCGATGGGGCCATTATTTTATTTGTGGATATAAGGGTTTTCATGAGTATGCAAAATCAGCAGGGCTGGATGTTGGTTCGCCAGTTGGACTTGATGTTATAATTGATGGAACAGTTCCTACATGTAATATAAATGTTCCAAGTACAGTTAATGGATTTACTTTTAGTAAAAAAAAAATTAAAAATACTTTTGTGTTTTACCTTGATCTCACAGGAAGATGTGAAAGATC...

CDS

Download CDS FASTA

411 bp · TkA05G000580|TK1151|CDS

ATGTGTTTGCAGGAAATTGACCTGAAGAATCATCGATGGGGCCATTATTTTATTTGTGGATATAAGGGTTTTCATGAGTATGCAAAATCAGCAGGGCTGGATGTTGGTTCGCCAGTTGGACTTGATGTTATAATTGATGGAACAGTTCCTACATGTAATATAAATGTTCCAAGTACAGTTAATGGATTTACTTTTAGTAAAAAAAAAATTAAAAATACTTTTGTGTTTTACCTTGATCTCACAGGAAGATGTGAAAGATC...

Protein

Download Protein FASTA

136 aa · TkA05G000580|TK1151|PROTEIN

MCLQEIDLKNHRWGHYFICGYKGFHEYAKSAGLDVGSPVGLDVIIDGTVPTCNINVPSTVNGFTFSKKKIKNTFVFYLDLTGRCERSCEANLRVLLEHKTTNSCRSIFRNGIQSLNFATLLNLCFVRSLQSFCQYR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G000580`
TK1151 ID	TkA05G000580
OH-1004 ID	LXL04_015369
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.500
Protein coverage (%)	TK1151 35.294 / OH-1004 9.619 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G000580

Location Chr05:145688-146189 (+)

Description Similar to GAL1: Galactokinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06580`	Sugar-1-kinase with a very high substrate specificity for the alpha-anomeric configuration of D-galacose (D-Gal).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015369 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0046835 carbohydrate phosphorylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004335 galactokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033858 N-acetylgalactosamine kinase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G06580

ddi:DDB_G0292112

hsa:2585

mmu:69976

rno:296117

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.414

Rank 1 · TkA05G000580 · TK1151

Cytoplasm0.397

Rank 2 · TkA05G000580 · TK1151

Mitochondrion0.129

Rank 3 · TkA05G000580 · TK1151

Cell membrane0.099

Rank 4 · TkA05G000580 · TK1151

Endoplasmic reticulum0.077

Rank 5 · TkA05G000580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEE5`	Arabidopsis thaliana	sp\|Q9SEE5\|GALK1_ARATH Galactokinase	52.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card