TkA05G000280 | RubberDandelionOmics

Gene overview

TkA05G000280

Reference: TK1151 Chr: Chr05 Coordinates: 58030-60485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA05G000280|TK1151|cDNA

ATGGGTGCCACCGGGACCGGAAAATCAAAACTTTCTATCGACCTCGCAACCCAATTCCAGGCTGAGATAATAAACGCCGACAAAATACAAATTTATAAAGGATTAGATGTTGTCACCAATAAAGTCACGACTGAAGAATGCAAAGGAGTGGCTCACCACCTTCTCGGGATAGCTGACCCAGAGTCAAATTTCACTGCAGAAAATTTCATAAGTGCGGTTTCACTTGCCATGAAATCGATTATTGGGAGAGGGAAGCTGTC...

CDS

Download CDS FASTA

759 bp · TkA05G000280|TK1151|CDS

ATGGGTGCCACCGGGACCGGAAAATCAAAACTTTCTATCGACCTCGCAACCCAATTCCAGGCTGAGATAATAAACGCCGACAAAATACAAATTTATAAAGGATTAGATGTTGTCACCAATAAAGTCACGACTGAAGAATGCAAAGGAGTGGCTCACCACCTTCTCGGGATAGCTGACCCAGAGTCAAATTTCACTGCAGAAAATTTCATAAGTGCGGTTTCACTTGCCATGAAATCGATTATTGGGAGAGGGAAGCTGTC...

Protein

Download Protein FASTA

252 aa · TkA05G000280|TK1151|PROTEIN

MGATGTGKSKLSIDLATQFQAEIINADKIQIYKGLDVVTNKVTTEECKGVAHHLLGIADPESNFTAENFISAVSLAMKSIIGRGKLSIIAGGSNSYIEALVDDENHEFQSRYDICFLWVDVAMVVLHQSLAERVDRMVDSGMVEEVRNIYKHNSDYSKGIRTAIGVPEFDSYFRAEHSSFSDEKTRAKLLEVAINETKINTCNLARRQVEKIYRLRDVKGWKIHRLDATKVFQKRVKKLTWRGLSLLQDPLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G000280`
TK1151 ID	TkA05G000280
OH-1004 ID	LXL04_018834
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 99.206 / OH-1004 75.758 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G000280

Location Chr05:58030-60485 (+)

Description Similar to IPT3: Adenylate isopentenyltransferase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63110`	Involved in cytokinin biosynthesis.	No verified direct reference in this release
`At5g19040`	Involved in cytokinin biosynthesis.	No verified direct reference in this release
`At3g23630`	Involved in cytokinin biosynthesis.	No verified direct reference in this release
`At1g68460`	Involved in cytokinin biosynthesis.	Roles of Arabidopsis ATP/ADP isopentenyltransferases and tRNA isopentenyltransferases in cytokinin biosynthesis.2006 · DOI: 10.1073/pnas.0603522103

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018834 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0009691 cytokinin biosynthetic process Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0034265 isopentenyl adenine biosynthetic process Biological Process

GO:0080117 secondary growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0009824 AMP dimethylallyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AAS94327

ath:AT1G68460

ath:AT3G23630

ath:AT3G63110

ath:AT5G19040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · TkA05G000280 · TK1151

Nucleus0.257

Rank 2 · TkA05G000280 · TK1151

Plastid0.182

Rank 3 · TkA05G000280 · TK1151

Mitochondrion0.090

Rank 4 · TkA05G000280 · TK1151

Peroxisome0.076

Rank 5 · TkA05G000280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01745IPT1-152 aa

PF01715IPPT30-103 aa

PF31070DUF880175-132 aa

PF01715IPPT107-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G000280	`PF01745`	IPT	1	152	3.4e-11	43.7
TkA05G000280	`PF01715`	IPPT	30	103	8.4e-39	134.4
TkA05G000280	`PF31070`	DUF8801	75	132	0.0032	17.8
TkA05G000280	`PF01715`	IPPT	107	209	8.4e-39	134.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WC9`	Arabidopsis thaliana	sp\|Q93WC9\|IPT3_ARATH Adenylate isopentenyltransferase 3, chloroplastic	60.000%	Swiss-Prot	High
`Q94ID2`	Arabidopsis thaliana	sp\|Q94ID2\|IPT5_ARATH Adenylate isopentenyltransferase 5, chloroplastic	58.600%	Swiss-Prot	High
`Q94ID1`	Arabidopsis thaliana	sp\|Q94ID1\|IPT7_ARATH Adenylate isopentenyltransferase 7, mitochondrial	54.600%	Swiss-Prot	High
`Q94ID3`	Arabidopsis thaliana	sp\|Q94ID3\|IPT1_ARATH Adenylate isopentenyltransferase 1, chloroplastic	47.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card