TkA04G513370 | RubberDandelionOmics

Gene overview

TkA04G513370

Reference: TK1151 Chr: Chr04 Coordinates: 129680823-129682382 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · TkA04G513370|TK1151|cDNA

AAAAAAAAAAAAACGAAGTGCCCCGGTTTGGACGGTTCAAAACAGAAAGCTGCACACAAAGTATTGTTCTTTGCTTTCTCTAGGGTTAGAGCTCCTAATCAGCAACGACAATGGAGGGATTGGATCCGACCACCAAGTCAACATTGACTCAAATTCCTCTCCTAACAGTAAAAGCCGGTCCTCGCGACGGCGCGTCATGGACTCAGCGCCTGAAGGAGGAGTACAAAGCCTTGATCGCATATACTTCAATGAACAAATCC...

CDS

Download CDS FASTA

525 bp · TkA04G513370|TK1151|CDS

ATGGAGGGATTGGATCCGACCACCAAGTCAACATTGACTCAAATTCCTCTCCTAACAGTAAAAGCCGGTCCTCGCGACGGCGCGTCATGGACTCAGCGCCTGAAGGAGGAGTACAAAGCCTTGATCGCATATACTTCAATGAACAAATCCAAAGACAACGATTGGTTTCGTATTTCTGCTGCTAATCCCGAAGGAACACGATGGACCGGAAAGTGTTGGTATGTGCATAATTTGCTCAAGTATGAATTCGATCTCCAATT...

Protein

Download Protein FASTA

174 aa · TkA04G513370|TK1151|PROTEIN

MEGLDPTTKSTLTQIPLLTVKAGPRDGASWTQRLKEEYKALIAYTSMNKSKDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTHKMYRGGKICLTVHFKPLWAKNSPRFGIAHALCLGLAPWLAAEIPVLVDSGMIKHKDDAVSTSET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G513370`
TK1151 ID	TkA04G513370
OH-1004 ID	LXL04_039178
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G513370

Location Chr04:129680823-129682382 (+)

Description Similar to At1g27530: Ubiquitin-fold modifier-conjugating enzyme 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27530`	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z5S8`	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	No verified direct reference in this release
`Os10g0205200`	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039178 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0061709 reticulophagy Biological Process

GO:0071569 protein ufmylation Biological Process

GO:1990592 protein K69-linked ufmylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0061657 UFM1 conjugating enzyme activity Molecular Function

GO:0071568 UFM1 transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G27530

ddi:DDB_G0289037

dosa:Os10g0205200

nve:5506607

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA04G513370 · TK1151

Nucleus0.381

Rank 2 · TkA04G513370 · TK1151

Cell membrane0.121

Rank 3 · TkA04G513370 · TK1151

Golgi apparatus0.119

Rank 4 · TkA04G513370 · TK1151

Endoplasmic reticulum0.100

Rank 5 · TkA04G513370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08694UFC18-163 aa

PF05773RWD80-102 aa

PF00179UQ_con81-122 aa

PF00179UQ_con106-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G513370	`PF08694`	UFC1	8	163	7.4e-84	279.8
TkA04G513370	`PF05773`	RWD	80	102	0.11	13.4
TkA04G513370	`PF00179`	UQ_con	81	122	0.0069	16.7
TkA04G513370	`PF00179`	UQ_con	106	135	0.0069	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXC8`	Arabidopsis thaliana	sp\|Q9SXC8\|UFC1_ARATH Ubiquitin-fold modifier-conjugating enzyme 1	87.900%	Swiss-Prot	High
`A2Z5S8`	Oryza sativa subsp. indica	sp\|A2Z5S8\|UFC1_ORYSI Ubiquitin-fold modifier-conjugating enzyme 1	79.800%	Swiss-Prot	High
`Q8S625`	Oryza sativa subsp. japonica	sp\|Q8S625\|UFC1_ORYSJ Ubiquitin-fold modifier-conjugating enzyme 1	79.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card