TkA04G508050 | RubberDandelionOmics

Gene overview

TkA04G508050

Reference: TK1151 Chr: Chr04 Coordinates: 128407121-128408440 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · TkA04G508050|TK1151|cDNA

ATGGACTCGACCATCTTTGCTTTCTTCTTCATTGCTTTTCTTTCGACCACAAGAGCTTTTGATCCATGTCCATATTTAAAACCCAAATCGGATGGCTCAGATCTCTCTATCATCCACATCTACGGTAAATGTTCACCATTCAACTCACCCAAACCGTCATCCTCATGGAGCACCACGGTCCTCAACATGGCCTCCAACGACCATCAAAGGCTAACCTTCTTATCGAGCATGGTTGCCAACAAGCCTATAACTTCGGTGCC...

CDS

Download CDS FASTA

1158 bp · TkA04G508050|TK1151|CDS

ATGGACTCGACCATCTTTGCTTTCTTCTTCATTGCTTTTCTTTCGACCACAAGAGCTTTTGATCCATGTCCATATTTAAAACCCAAATCGGATGGCTCAGATCTCTCTATCATCCACATCTACGGTAAATGTTCACCATTCAACTCACCCAAACCGTCATCCTCATGGAGCACCACGGTCCTCAACATGGCCTCCAACGACCATCAAAGGCTAACCTTCTTATCGAGCATGGTTGCCAACAAGCCTATAACTTCGGTGCC...

Protein

Download Protein FASTA

385 aa · TkA04G508050|TK1151|PROTEIN

MDSTIFAFFFIAFLSTTRAFDPCPYLKPKSDGSDLSIIHIYGKCSPFNSPKPSSSWSTTVLNMASNDHQRLTFLSSMVANKPITSVPIAPGQVINIGNYVARVKLGTPGQLMFMVLDISADLAWVPCTGCTGCSSTLFSPNTSITYGPLDCTSSECVQAHGLSCPMSGPDSCLFNQSYGGDSSFLATLSHDFLQLANDTFPSYVFGCIGSVSGKSIPPQGLLGLGRGSMSILAQSGSFYSGRVKVPIAPELLAFNPSTGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G508050`
TK1151 ID	TkA04G508050
OH-1004 ID	LXL04_039138
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G508050

Location Chr04:128407121-128408440 (+)

Description Similar to AED3: Aspartyl protease AED3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09750`	Aspartyl protease AED3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186900`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396
`UniProt: A2ZC67`	Possesses protease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT1G09750

ath:AT5G10770

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.472

Rank 1 · TkA04G508050 · TK1151

Cell membrane0.182

Rank 2 · TkA04G508050 · TK1151

Endoplasmic reticulum0.135

Rank 3 · TkA04G508050 · TK1151

Cytoplasm0.098

Rank 4 · TkA04G508050 · TK1151

Lysosome / Vacuole0.065

Rank 5 · TkA04G508050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026Asp98-231 aa

PF14543TAXi_N99-238 aa

PF14541TAXi_C242-380 aa

PF00026Asp257-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G508050	`PF00026`	Asp	98	231	3.1e-11	44.0
TkA04G508050	`PF14543`	TAXi_N	99	238	9.6e-27	95.0
TkA04G508050	`PF14541`	TAXi_C	242	380	2.3e-21	77.0
TkA04G508050	`PF00026`	Asp	257	381	3.1e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04496`	Arabidopsis thaliana	sp\|O04496\|AED3_ARATH Aspartyl protease AED3	51.100%	Swiss-Prot	High
`Q6F4N5`	Oryza sativa subsp. japonica	sp\|Q6F4N5\|AP25_ORYSJ Aspartyl protease 25	45.700%	Swiss-Prot	Medium
`A2ZC67`	Oryza sativa subsp. indica	sp\|A2ZC67\|ASP1_ORYSI Aspartic proteinase Asp1	32.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card