TkA04G506980 | RubberDandelionOmics

Gene overview

TkA04G506980

Reference: TK1151 Chr: Chr04 Coordinates: 128081287-128082213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · TkA04G506980|TK1151|cDNA

ATGAAGGGAGAATATCGAGAAGATAAAACTCACCCCCCTTCTACCACCATGTTCTCAAAATTCCACCATCACCAAACACCTCCGCCGCAGCATTTCGCCATCACCAACCACCAATTTCAGCTCAGCAACACATCGGAAGAAGCCGATAGCCGCAGCCGTAGTCCCAACCATGCGATCACACCTACCCTTGCCAAGAAAGATGTCAACGACGGTGCATCGATCGAGGTGGCCAGACGACCAAGAGGCCGGCCGCCGGGATC...

CDS

Download CDS FASTA

897 bp · TkA04G506980|TK1151|CDS

ATGAAGGGAGAATATCGAGAAGATAAAACTCACCCCCCTTCTACCACCATGTTCTCAAAATTCCACCATCACCAAACACCTCCGCCGCAGCATTTCGCCATCACCAACCACCAATTTCAGCTCAGCAACACATCGGAAGAAGCCGATAGCCGCAGCCGTAGTCCCAACCATGCGATCACACCTACCCTTGCCAAGAAAGATGTCAACGACGGTGCATCGATCGAGGTGGCCAGACGACCAAGAGGCCGGCCGCCGGGATC...

Protein

Download Protein FASTA

298 aa · TkA04G506980|TK1151|PROTEIN

MKGEYREDKTHPPSTTMFSKFHHHQTPPPQHFAITNHQFQLSNTSEEADSRSRSPNHAITPTLAKKDVNDGASIEVARRPRGRPPGSKNKPKPPVVITREAEPSMSPYVLELPGGIDIVDAVARYCRKRNIGLSVLTGSGTVANVSLRQPSSTPAATVTFHGRFDLLSISATVLPSSLSPSSAVAAFANGFTISLAGPQGQIVGGAVSGPLMSAGTVYIIAASFNNPLYHRLPSEEDDNLRNSGGVTAGSGSAGGDSGGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G506980`
TK1151 ID	TkA04G506980
OH-1004 ID	LXL04_039134
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G506980

Location Chr04:128081287-128082213 (-)

Description Similar to AHL17: AT-hook motif nuclear-localized protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49700`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At1g14490`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g45430`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	Over-expression of an AT-hook gene, AHL22, delays flowering and inhibits the elongation of the hypocotyl in Arabidopsis thaliana.2009 · DOI: 10.1007/s11103-009-9507-9 The AT-hook motif-containing protein AHL22 regulates flowering initiation by modifying FLOWERING LOCUS T chromatin in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.318477
`At4g12050`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g17800`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039134 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003680 minor groove of adenine-thymine-rich DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042826 histone deacetylase binding Molecular Function

KEGG gene cross-reference

ath:AT1G14490

ath:AT1G76500

ath:AT2G45430

ath:AT4G12050

ath:AT5G49700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA04G506980 · TK1151

Cytoplasm0.094

Rank 2 · TkA04G506980 · TK1151

Cell membrane0.031

Rank 3 · TkA04G506980 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA04G506980 · TK1151

Plastid0.014

Rank 5 · TkA04G506980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479PCC101-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G506980	`PF03479`	PCC	101	225	1.3e-24	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTA2`	Arabidopsis thaliana	sp\|Q9LTA2\|AHL17_ARATH AT-hook motif nuclear-localized protein 17	53.800%	Swiss-Prot	High
`Q9M9R4`	Arabidopsis thaliana	sp\|Q9M9R4\|AHL28_ARATH AT-hook motif nuclear-localized protein 28	58.400%	Swiss-Prot	Medium
`O22130`	Arabidopsis thaliana	sp\|O22130\|AHL22_ARATH AT-hook motif nuclear-localized protein 22	48.900%	Swiss-Prot	Medium
`Q9SZ70`	Arabidopsis thaliana	sp\|Q9SZ70\|AHL26_ARATH AT-hook motif nuclear-localized protein 26	48.800%	Swiss-Prot	Medium
`O23620`	Arabidopsis thaliana	sp\|O23620\|AHL23_ARATH AT-hook motif nuclear-localized protein 23	55.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card