TkA04G504790 | RubberDandelionOmics

Gene overview

TkA04G504790

Reference: TK1151 Chr: Chr04 Coordinates: 127501929-127503850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1175 bp · TkA04G504790|TK1151|cDNA

TGTTCATACACTGCTTCTTCCTCTTGGTTGTATAAAATTCACTCAGATTTTGAGAAAGACTCAACAACAGAATTAATTTTCTCATATCTTCATTCTCCATTCTTCCATTTCAAGTTTGTTTTTCAAAGACCCACAACGCAAGCTTCTTGATTTTGCTCAAGTTTCCTCGAAGTTATGAAGAGAAACTTCAGTTGCTCTGATTCTTTGACTCATTTTCTCTCACACCCACTTGAAGGGGAGATAAAAGCAGAAGAAGACTG...

CDS

Download CDS FASTA

897 bp · TkA04G504790|TK1151|CDS

ATGAAGAGAAACTTCAGTTGCTCTGATTCTTTGACTCATTTTCTCTCACACCCACTTGAAGGGGAGATAAAAGCAGAAGAAGACTGCATTTTCAACGGAGAATTTCAATCAATGGTAGACGGCCGTGGTGGCGGAGATGGAGAAGATTACGGTGGGGAAGAAACAGGGCAATTCGGTGACAAAAAGAGAAGATTAAGCAATCATCAAGTGAAATCATTAGAGAAAATATTTGAAGTCGATAACAAACTTGACCCAGAAAG...

Protein

Download Protein FASTA

298 aa · TkA04G504790|TK1151|PROTEIN

MKRNFSCSDSLTHFLSHPLEGEIKAEEDCIFNGEFQSMVDGRGGGDGEDYGGEETGQFGDKKRRLSNHQVKSLEKIFEVDNKLDPERKVKVAQDLGLQPRQVAIWFQNRRARWKTKQLERDYNLLKSSYDTLKHNYHKLEKEKEIIIKELVELKAKLHEETTQGSEEFEDRENVLFLGSDPTDTNHEVYTSLNYESTRKSLDLKDGFSDSDSSGVLNEENMNVSNDNGSSSLNMASFGLSSLCSSSATTSNHTGHVDPRT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G504790`
TK1151 ID	TkA04G504790
OH-1004 ID	LXL04_039109
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G504790

Location Chr04:127501929-127503850 (-)

Description Similar to ATHB-16: Homeobox-leucine zipper protein ATHB-16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65310`	Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment.	No verified direct reference in this release
`At4g40060`	Probable transcription factor that may function as a negative regulator of the flowering time response to photoperiod.	No verified direct reference in this release
`At2g22430`	Transcription activator that may act as growth regulators in response to water deficit.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XDD6`	Probable transcription factor.	No verified direct reference in this release
`UniProt: Q9XH35`	Probable transcription factor that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039109 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009637 response to blue light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G22430

ath:AT4G40060

ath:AT5G65310

dosa:Os09g0470500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · TkA04G504790 · TK1151

Cytoplasm0.086

Rank 2 · TkA04G504790 · TK1151

Cell membrane0.022

Rank 3 · TkA04G504790 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA04G504790 · TK1151

Plastid0.010

Rank 5 · TkA04G504790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19098DUF578556-108 aa

PF00046Homeodomain61-114 aa

PF05920Homeobox_KN85-112 aa

PF03961FapA102-173 aa

PF06428Sec2p111-160 aa

PF25450Rab11-FIP3112-163 aa

PF13094CENP-Q114-202 aa

PF02183HALZ116-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G504790	`PF19098`	DUF5785	56	108	0.076	14.2
TkA04G504790	`PF00046`	Homeodomain	61	114	2.5e-17	63.1
TkA04G504790	`PF05920`	Homeobox_KN	85	112	0.0023	18.4
TkA04G504790	`PF03961`	FapA	102	173	0.61	10.4
TkA04G504790	`PF06428`	Sec2p	111	160	0.11	13.4
TkA04G504790	`PF25450`	Rab11-FIP3	112	163	0.00088	20.3
TkA04G504790	`PF13094`	CENP-Q	114	202	0.14	13.0
TkA04G504790	`PF02183`	HALZ	116	157	1.4e-12	48.3
TkA04G504790	`PF29658`	YonG_2nd	120	173	0.017	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46667`	Arabidopsis thaliana	sp\|P46667\|ATHB5_ARATH Homeobox-leucine zipper protein ATHB-5	46.700%	Swiss-Prot	Medium
`Q940J1`	Arabidopsis thaliana	sp\|Q940J1\|ATB16_ARATH Homeobox-leucine zipper protein ATHB-16	36.000%	Swiss-Prot	Medium
`P46668`	Arabidopsis thaliana	sp\|P46668\|ATHB6_ARATH Homeobox-leucine zipper protein ATHB-6	47.200%	Swiss-Prot	Medium
`A2XDD6`	Oryza sativa subsp. indica	sp\|A2XDD6\|HOX13_ORYSI Homeobox-leucine zipper protein HOX13	56.400%	Swiss-Prot	Low
`Q9XH35`	Oryza sativa subsp. indica	sp\|Q9XH35\|HOX6_ORYSI Homeobox-leucine zipper protein HOX6	55.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card