TkA04G502890 | RubberDandelionOmics

Gene overview

TkA04G502890

Reference: TK1151 Chr: Chr04 Coordinates: 127016165-127019261 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1199 bp · TkA04G502890|TK1151|cDNA

TTCCAATCCCTTTTCTTTACCCCTATAACCTATAAATACCACTTCCCCTTCCTCTCCAATCCTCCTCCTCTGCCCTCTTATTGTCTGCTTCCTTCACATCATTCATGGATTCCTACTCCCCTTTTGATTCCCTCATCTTCGATTTGGATGATACTTTATACTCTTCAAACCTTGGATTCGGTGATGCAACTAAGCATAACATCGACGATTTCCTCGTTGAGAAATGCGGATTTGAACAGAGGAAAGCTTCGGCTCTTCGT...

CDS

Download CDS FASTA

777 bp · TkA04G502890|TK1151|CDS

ATGGATTCCTACTCCCCTTTTGATTCCCTCATCTTCGATTTGGATGATACTTTATACTCTTCAAACCTTGGATTCGGTGATGCAACTAAGCATAACATCGACGATTTCCTCGTTGAGAAATGCGGATTTGAACAGAGGAAAGCTTCGGCTCTTCGTGCTCAACTTTTTAAAACTTACGGAAGCACTCTTGCCGGTTTAAGAGCGTTAGGCTATGATGTACAGGCAGATGATTATCATCGCATCGTGCACGGAAGATTGCC...

Protein

Download Protein FASTA

258 aa · TkA04G502890|TK1151|PROTEIN

MDSYSPFDSLIFDLDDTLYSSNLGFGDATKHNIDDFLVEKCGFEQRKASALRAQLFKTYGSTLAGLRALGYDVQADDYHRIVHGRLPYHLIKPDPQLRNLLLAISQRKIIFTNSDRAHAMKALNLLGIDDCFEQIICFETMNPNLFNSKSTSPQEFPVVLKPSLEAINIAMDVAEVDPNRTLFLDDNVRNIAAGKSVGLRTVLVGKTIKTKEADYALESIHNLMKVVPEIWLTKNDKNVLKRNSSDLNLALNPTHVVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G502890`
TK1151 ID	TkA04G502890
OH-1004 ID	LXL04_036160
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.300
Protein coverage (%)	TK1151 97.674 / OH-1004 94.719 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G502890`
Location	Chr04:127016165-127019261 (-)
Description	Similar to SPAC24B11.05: Uncharacterized protein C24B11.05 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036160` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006206 pyrimidine nucleobase metabolic process Biological Process GO:0009166 nucleotide catabolic process Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0070328 triglyceride homeostasis Biological Process GO:0090549 response to carbon starvation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008252 nucleotidase activity Molecular Function GO:0008253 5'-nucleotidase activity Molecular Function GO:0052642 lysophosphatidic acid phosphatase activity Molecular Function
KEGG gene cross-reference	sce:YER037W sce:YGL224C spo:2541562 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.527

Rank 1 · TkA04G502890 · TK1151

Nucleus0.430

Rank 2 · TkA04G502890 · TK1151

Plastid0.072

Rank 3 · TkA04G502890 · TK1151

Mitochondrion0.061

Rank 4 · TkA04G502890 · TK1151

Cell membrane0.047

Rank 5 · TkA04G502890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase9-198 aa

PF12689Acid_PPase10-20 aa

PF11019DUF260810-49 aa

PF03031NIF10-23 aa

PF13419HAD_211-204 aa

PF03031NIF109-193 aa

PF12689Acid_PPase118-219 aa

PF13242Hydrolase_like161-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G502890	`PF00702`	Hydrolase	9	198	3.1e-13	51.3
TkA04G502890	`PF12689`	Acid_PPase	10	20	0.013	16.1
TkA04G502890	`PF11019`	DUF2608	10	49	0.068	13.4
TkA04G502890	`PF03031`	NIF	10	23	0.11	12.9
TkA04G502890	`PF13419`	HAD_2	11	204	2e-12	48.2
TkA04G502890	`PF03031`	NIF	109	193	0.11	12.9
TkA04G502890	`PF12689`	Acid_PPase	118	219	0.013	16.1
TkA04G502890	`PF13242`	Hydrolase_like	161	213	0.0001	22.9
TkA04G502890	`PF11019`	DUF2608	167	193	0.068	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card